Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YML124C and Homologs


Choose two or more sequences for alignment:
Pick a sequence type:
Best Hits & Orthologs"Other" Hits

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_TUB3/YML124C   1   ---MREVISINVGQAGCQIGNACWELYSLEHGIKEDGHLEDGLSKPKGGE   47
MIT_Suva_c553_18321   1   MNCFTYIYICAVGQAGCQIGNACWELYSLEHGIKSDGHLEDGLSKPKGGE   50
WashU_Sbay_Contig604.11   1   MNCFTYIYICAVGQAGCQIGNACWELYSLEHGIKSDGHLEDGLSKPKGGE   50
WashU_Smik_Contig2715.6   
   --------------------------------------------------   
Symbols










SGD_Scer_TUB3/YML124C   48   EGFSTFFHETGYGKFVPRAIYVDLEPNVIDEVRTGRFKELFHPEQLINGK   97
MIT_Suva_c553_18321   51   EGFSTFFHETGYGKFVPRAIYVDLEPNVIDEVRTGRFKDLFHPEQLINGK   100
WashU_Sbay_Contig604.11   51   EGFSTFFHETGYGKFVPRAIYVDLEPNVIDEVRTGRFKDLFHPEQLINGK   100
WashU_Smik_Contig2715.6   
   --------------------------------------------------   
Symbols










SGD_Scer_TUB3/YML124C   98   EDAANNYARGHYTVGREIVDEVEERIRKMADQCDGLQGFLFTHSLGGGTG   147
MIT_Suva_c553_18321   101   EDAANNYARGHYTVGREIVDEVEERIRKMADQCDGLQGFLFTHSLGGGTG   150
WashU_Sbay_Contig604.11   101   EDAANNYARGHYTVGREIVDEVEERIRKMADQCDGLQGFLFTHSLGGGTG   150
WashU_Smik_Contig2715.6   1   ----------------------------MADQCDGLQGFLFTHSLGGGTG   22
Symbols






**********************



SGD_Scer_TUB3/YML124C   148   SGLGSLLLENLSYEYGKKSKLEFAVYPAPQLSTSVVEPYNTVLTTHTTLE   197
MIT_Suva_c553_18321   151   SGLGSLLLENLSYEYGKKSKLEFAVYPAPQLSTSVVEPYNTVLTTHTTLE   200
WashU_Sbay_Contig604.11   151   SGLGSLLLENLSYEYGKKSKLEFAVYPAPQLSTSVVEPYNTVLTTHTTLE   200
WashU_Smik_Contig2715.6   23   SGLGSLLLENLSYEYGKKSKLEFAVYPAPQLSTSVVEPYNTVLTTHTTLE   72
Symbols






**************************************************



SGD_Scer_TUB3/YML124C   198   HADCTFMVDNEAIYDICKRNLGISRPSFSNLNGLIAQVISSVTASLRFDG   247
MIT_Suva_c553_18321   201   HADCTFMVDNEAIYDICKRNLSISRPSFDNLNGLIAQVVSSVTASLRFDG   250
WashU_Sbay_Contig604.11   201   HADCTFMVDNEAIYDICKRNLSISRPSFDNLNGLIAQVVSSVTASLRFDG   250
WashU_Smik_Contig2715.6   73   HADCTFMVDNEAIYDICKRNLGISRPSFSNLNGLIAQVVSSVTASLRFDG   122
Symbols






*********************.******.*********:***********



SGD_Scer_TUB3/YML124C   248   SLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKKRATHESNSVSEITNACF   297
MIT_Suva_c553_18321   251   SLNVDLNEFQTNLVPYPRIHFPLVSYAPILSNKRATHESNSVSEITNACF   300
WashU_Sbay_Contig604.11   251   SLNVDLNEFQTNLVPYPRIHFPLVSYAPILSNKRATHESNSVSEITNACF   300
WashU_Smik_Contig2715.6   123   SLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKKRATHESNSVSEITNACF   172
Symbols






*******************************:******************



SGD_Scer_TUB3/YML124C   298   EPGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDW   347
MIT_Suva_c553_18321   301   EPGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDW   350
WashU_Sbay_Contig604.11   301   EPGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDW   350
WashU_Smik_Contig2715.6   173   ETGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDW   222
Symbols






*.************************************************



SGD_Scer_TUB3/YML124C   348   CPTGFKIGICYEPPSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFD   397
MIT_Suva_c553_18321   351   CPTGFKIGICYEPPTVIPSSELASVDRAVCMLSNTTAIAEAWKRIDRKFD   400
WashU_Sbay_Contig604.11   351   CPTGFKIGICYEPPTVIPSSELASVDRAVCMLSNTTAIAEAWKRIDRKFD   400
WashU_Smik_Contig2715.6   223   CPTGFKIGICYEPPTVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFD   272
Symbols






**************:********.***************:******:***



SGD_Scer_TUB3/YML124C   398   LMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADSYAEEF   445
MIT_Suva_c553_18321   401   LMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADSYAEEF   448
WashU_Sbay_Contig604.11   401   LMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADSYAEEF   448
WashU_Smik_Contig2715.6   273   LMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADSYAEEF   320
Symbols






************************************************



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_TUB3/YML124C:

SGD_Scer_TUB3/YML124C  Length: 446  Mon Nov  7 16:15:04 2016  Type: P  Check: 462  ..

       1  MREVISINVG QAGCQIGNAC WELYSLEHGI KEDGHLEDGL SKPKGGEEGF

      51  STFFHETGYG KFVPRAIYVD LEPNVIDEVR TGRFKELFHP EQLINGKEDA

     101  ANNYARGHYT VGREIVDEVE ERIRKMADQC DGLQGFLFTH SLGGGTGSGL

     151  GSLLLENLSY EYGKKSKLEF AVYPAPQLST SVVEPYNTVL TTHTTLEHAD

     201  CTFMVDNEAI YDICKRNLGI SRPSFSNLNG LIAQVISSVT ASLRFDGSLN

     251  VDLNEFQTNL VPYPRIHFPL VSYAPILSKK RATHESNSVS EITNACFEPG

     301  NQMVKCDPTK GKYMANCLLY RGDVVTRDVQ RAVEQVKNKK TVQMVDWCPT

     351  GFKIGICYEP PSVIPSSELA NVDRAVCMLS NTTAIADAWK RIDQKFDLMY

     401  AKRAFVHWYV GEGMEEGEFT EAREDLAALE RDYIEVGADS YAEEF*


Protein Sequence for MIT_Suva_c553_18321:

MIT_Suva_c553_18321  Length: 449  Mon Nov  7 16:15:04 2016  Type: P  Check: 3965  ..

       1  MNCFTYIYIC AVGQAGCQIG NACWELYSLE HGIKSDGHLE DGLSKPKGGE

      51  EGFSTFFHET GYGKFVPRAI YVDLEPNVID EVRTGRFKDL FHPEQLINGK

     101  EDAANNYARG HYTVGREIVD EVEERIRKMA DQCDGLQGFL FTHSLGGGTG

     151  SGLGSLLLEN LSYEYGKKSK LEFAVYPAPQ LSTSVVEPYN TVLTTHTTLE

     201  HADCTFMVDN EAIYDICKRN LSISRPSFDN LNGLIAQVVS SVTASLRFDG

     251  SLNVDLNEFQ TNLVPYPRIH FPLVSYAPIL SNKRATHESN SVSEITNACF

     301  EPGNQMVKCD PTKGKYMANC LLYRGDVVTR DVQRAVEQVK NKKTVQMVDW

     351  CPTGFKIGIC YEPPTVIPSS ELASVDRAVC MLSNTTAIAE AWKRIDRKFD

     401  LMYAKRAFVH WYVGEGMEEG EFTEAREDLA ALERDYIEVG ADSYAEEF*


Protein Sequence for WashU_Sbay_Contig604.11:

WashU_Sbay_Contig604.11  Length: 449  Mon Nov  7 16:15:04 2016  Type: P  Check: 3965  ..

       1  MNCFTYIYIC AVGQAGCQIG NACWELYSLE HGIKSDGHLE DGLSKPKGGE

      51  EGFSTFFHET GYGKFVPRAI YVDLEPNVID EVRTGRFKDL FHPEQLINGK

     101  EDAANNYARG HYTVGREIVD EVEERIRKMA DQCDGLQGFL FTHSLGGGTG

     151  SGLGSLLLEN LSYEYGKKSK LEFAVYPAPQ LSTSVVEPYN TVLTTHTTLE

     201  HADCTFMVDN EAIYDICKRN LSISRPSFDN LNGLIAQVVS SVTASLRFDG

     251  SLNVDLNEFQ TNLVPYPRIH FPLVSYAPIL SNKRATHESN SVSEITNACF

     301  EPGNQMVKCD PTKGKYMANC LLYRGDVVTR DVQRAVEQVK NKKTVQMVDW

     351  CPTGFKIGIC YEPPTVIPSS ELASVDRAVC MLSNTTAIAE AWKRIDRKFD

     401  LMYAKRAFVH WYVGEGMEEG EFTEAREDLA ALERDYIEVG ADSYAEEF*


Protein Sequence for WashU_Smik_Contig2715.6:

WashU_Smik_Contig2715.6  Length: 321  Mon Nov  7 16:15:04 2016  Type: P  Check: 5508  ..

       1  MADQCDGLQG FLFTHSLGGG TGSGLGSLLL ENLSYEYGKK SKLEFAVYPA

      51  PQLSTSVVEP YNTVLTTHTT LEHADCTFMV DNEAIYDICK RNLGISRPSF

     101  SNLNGLIAQV VSSVTASLRF DGSLNVDLNE FQTNLVPYPR IHFPLVSYAP

     151  ILSKKRATHE SNSVSEITNA CFETGNQMVK CDPTKGKYMA NCLLYRGDVV

     201  TRDVQRAVEQ VKNKKTVQMV DWCPTGFKIG ICYEPPTVIP SSELANVDRA

     251  VCMLSNTTAI ADAWKRIDQK FDLMYAKRAF VHWYVGEGME EGEFTEARED

     301  LAALERDYIE VGADSYAEEF *