Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YML006C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_GIS4/YML006C   1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNS   50
MIT_Smik_c567_16380   1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNS   50
MIT_Spar_c187_17356   1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNS   50
MIT_Suva_c537_17785   1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNS   50
WashU_Sbay_Contig638.5   1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNS   50
WashU_Scas_Contig714.55   1   MQKSVRVTDYFDNDDNGLWSWYLTNIRLGDFEEVTGNQLKYTLLKRFLNS   50
WashU_Skud_Contig2043.3   1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNS   50
Symbols






******* *****************:*******: ***************



SGD_Scer_GIS4/YML006C   51   HFYGDNNISARPN----------------------KKILLVSIPENVHED   78
MIT_Smik_c567_16380   51   HFYGDNSISVRSN----------------------KKILLVSIPENVHED   78
MIT_Spar_c187_17356   51   HFYGDNSIWARPN----------------------KKILLVSIPENVHED   78
MIT_Suva_c537_17785   51   HFYGDNNTSIRPN----------------------KKILLVSIPENVHED   78
WashU_Sbay_Contig638.5   51   HFYGDNNTSIRPN----------------------KKILLVSIPENVHED   78
WashU_Scas_Contig714.55   51   HFYSNSDVTATESPQQHNNNNNTNNNNTQQLKPNFRKILLVSIPDKVHRD   100
WashU_Skud_Contig2043.3   51   HFYGDYNTSARPN----------------------KKILLVSIPENVHED   78
Symbols






***.: . . :********::**.*



SGD_Scer_GIS4/YML006C   79   ISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDNLNNFQDPT   128
MIT_Smik_c567_16380   79   ISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDNLNNFQDPT   128
MIT_Spar_c187_17356   79   ISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDNLNNFQDPT   128
MIT_Suva_c537_17785   79   ISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDYLNNFQDPS   128
WashU_Sbay_Contig638.5   79   ISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDYLNNFQDPS   128
WashU_Scas_Contig714.55   101   LSILETFLRDYFHLEHLEGIQIQRLTQSKCYNHENHYLLTDTINNFDDPV   150
WashU_Skud_Contig2043.3   79   ISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDNLNNFQDPT   128
Symbols






:**** **:******:** ***.:**:*:************ :***:**



SGD_Scer_GIS4/YML006C   129   FLEFASTSWQVQKNSKALNNNN-RNSIPPPTISSSKASNGKLESNVSDDQ   177
MIT_Smik_c567_16380   129   FLEFASTSWQVQKNSKALNNNN-RSLIHPPTISSSKTSNGQLKSSTSDEQ   177
MIT_Spar_c187_17356   129   FLEFASTSWQVQKNSKALNNN--RNSIQPPPISSSKTSNGKSKPNISDDQ   176
MIT_Suva_c537_17785   129   FLEFASTSWQVQKNPKSLNNNNNRHLIHASTASSSKPSNAQLKPNTLDDQ   178
WashU_Sbay_Contig638.5   129   FLEFASTSWQVQKNPKSLNNNNNRHLIHASTASSSKPSNAQLKPNTLDDQ   178
WashU_Scas_Contig714.55   151   FLEFAGSNWQARKN------------------------------------   164
WashU_Skud_Contig2043.3   129   FLEFASTSWQVQKNSKTLNNNN-RYLMHGSTISSSKTSTGQLKPNTLDDQ   177
Symbols






*****.:.**.:**



SGD_Scer_GIS4/YML006C   178   WSNINTQTSTATRTNTNTRTLTSPDTVDINVTSVN-SQSNNNDTPQDNEN   226
MIT_Smik_c567_16380   178   WSNINTQTPTGTRTNTNTRTITSPDTADICLTSAN-RQSNNYAVPQDSEN   226
MIT_Spar_c187_17356   177   WS---KKTATATRTNTNTRTLTSPDTVDINATANG-QNNNHDVPQNNNVN   222
MIT_Suva_c537_17785   179   LLDINTQTSMTARTNTNTKTLTYTDTADPSLTQPECNNKGDNDMPQNNEN   228
WashU_Sbay_Contig638.5   179   LLDINTQTSMTARTNTNTKTLTYTDTADPSLTQPECNNKGDNDMPQNNEN   228
WashU_Scas_Contig714.55   165   -LHLNNHLDHRDDDRISPQSIDTHSALNKNDDQILVTQPIDSTLVTPETR   213
WashU_Skud_Contig2043.3   178   WSNINTQTSTATRTNTNTRTLTSPDTADLSLTPTNGDNN-NNDVLQSNEN   226
Symbols






.: . ..::: .: : : . . .



SGD_Scer_GIS4/YML006C   227   EVDEE----DATSSIVLNFSHSRTVDSKPNRLPKIFPSYTNEDYTP----   268
MIT_Smik_c567_16380   227   RNDGEDAADDTTSSIVLNFSHSRALEPKTSRLPKIFPPYTNEEYTP----   272
MIT_Spar_c187_17356   223   ENDEEDAGDDATSSIVLNFSHSRTVDPKPNRLPKIFPSYTNEEYTP----   268
MIT_Suva_c537_17785   229   ENEEEDAGDDAASSIVLNFSHPRTLASKANRAPKIFPSYTNEDYNP----   274
WashU_Sbay_Contig638.5   229   ENEEEDAGDDAASSIVLNFSHPRTLASKANRAPKIFPSYTNEDYNP----   274
WashU_Scas_Contig714.55   214   EKENLDDIDVGGSSIVLNFSHTREHRKDKDPLNMVKQEEQSNKFSPNMMF   263
WashU_Skud_Contig2043.3   227   ENAEEDAGEDATSSIVLNFSHSRTLASKANRLPKILPSYTNEDYTP----   272
Symbols






. *********.* . . : .:.:.*



SGD_Scer_GIS4/YML006C   269   --SHSEIMSIDSFAGEDVSSTYPGQDLSLTTARREDESGQDE---VEDHY   313
MIT_Smik_c567_16380   273   --SHSEIVSIDSFAGEDVSSTYPGQDLSLTTARCEDDNDQDD---VEGHY   317
MIT_Spar_c187_17356   269   --SHSEIISIDSFAGEDLSSTYPGQDLSLTTARREDENDQDG---VEDHY   313
MIT_Suva_c537_17785   275   --SHSEIVSIDSFAGEDVSSTYPGQDLSLTTARREDKDDED---------   313
WashU_Sbay_Contig638.5   275   --SHSEIVSIDSFAGEDVSSTYPGQDLSLTTARREDKDDED---------   313
WashU_Scas_Contig714.55   264   TPPQSELVSINSFD-DGDSMNYNGHPLKLTLTRQDEESIAQLE-------   305
WashU_Skud_Contig2043.3   273   --SHSEIVSIDSFTGEDASSTYPGQDLSLTTARREDANDENDENESEDHY   320
Symbols






.:**::**:** :. * .* *: *.** :* :: . :



SGD_Scer_GIS4/YML006C   314   SRVSHDLGDESIDQASYSMESSVSYTSYSSSSNSSSAHYSLSSSSRGNPK   363
MIT_Smik_c567_16380   318   NRTSNDLNDKSTNQIRLNMESSVSCTSCSSSS-SSSIRYSLSSTSRASLK   366
MIT_Spar_c187_17356   314   TRVSNDLGDERIDQASSSMESSISCTSCSSSSDSRSARYSLSGSSRGSLK   363
MIT_Suva_c537_17785   314   -RSSNGFDDESFEETSSSIESSVNYTNCSSSSNSSIVRYHFNSSSRGSLG   362
WashU_Sbay_Contig638.5   314   -RSSNGFDDESFEETSSSIESSVNYTNCSSSSNSSIVRYHFNSSSRGSLG   362
WashU_Scas_Contig714.55   306   -----QDKQAEYPTATTTTTATITATNNNINNNTYHNLHDHKLTPEESIQ   350
WashU_Skud_Contig2043.3   321   NRNSDGFHDEGNEQVSLGIESCVSYSSCSSSSIGSSVRYSLSGNRRDSLR   370
Symbols






: : :. :. . .. : . . . .



SGD_Scer_GIS4/YML006C   364   RENIDHTNATYVSELSSITSSIDNLTTSTTPEEEDNLIHHNYDAQGYGSG   413
MIT_Smik_c567_16380   367   RESADHTNATYVSELSSITSSIDNLTTSTTPEEEDHLIHHNYDAQGYASR   416
MIT_Spar_c187_17356   364   HGDADHTNATYVSELSSITSSIDNLTTSTTPEEEDHLIHRNYDAQGYASG   413
MIT_Suva_c537_17785   363   RGDVDHTNATYVSELSSITSSIENVTNSTTPEEEDHLVRNNYDTREYISG   412
WashU_Sbay_Contig638.5   363   RGDVDHTNATYVSELSSITSSIENVTNSTTPEEEDHLVRNNYDTREYISG   412
WashU_Scas_Contig714.55   351   SYEIGKSSITDMSSLKRSLNSIG-TDSSSSISRREILNLDRTDIEEGEVD   399
WashU_Skud_Contig2043.3   371   NGNVDHTNATYVSELSSITSSIDNLTTSTTPEEEENLVQNNYDAREYISG   420
Symbols






. .::. * :*.*. .** .*:: ...: * . * .



SGD_Scer_GIS4/YML006C   414   EDDGEEVYDDEDLSSSDYSVLSILPSISICDSLG-YFRLVLQSILIQDPD   462
MIT_Smik_c567_16380   417   EDEVEEVDDDADLSSSDYSVLSILPSISICDSLG-YFRLVLQSILIQDPD   465
MIT_Spar_c187_17356   414   EDDGEEVYDDEDLSSSDYSVLSILPSISICDSLG-YFRLVLQSILIQDPD   462
MIT_Suva_c537_17785   413   EEDEEEVDDEEDISSSDYSILSILPSISICDSLG-YFRLVLQSILIQNPD   461
WashU_Sbay_Contig638.5   413   EEDEEEVDDEEDISSSDYSILSILPSISICDSLG-YFRLVLQSILIQNPD   461
WashU_Scas_Contig714.55   400   DRDDEDEDEDIDDLSSDYSVLSILPSISISDAIEGHFRLVLQSILIQHPV   449
WashU_Skud_Contig2043.3   421   EEDGEGADEDEDISSSDYSVLSILPSISICDSLG-YFRLVLQSILIQDPD   469
Symbols






: : * :: * *****:*********.*:: :***********.*



SGD_Scer_GIS4/YML006C   463   TKEIFTAIRQSNNKPTMASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRS   512
MIT_Smik_c567_16380   466   TKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRS   515
MIT_Spar_c187_17356   463   TKEIFTAIRQSNNKPTIASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRS   512
MIT_Suva_c537_17785   462   TKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRS   511
WashU_Sbay_Contig638.5   462   TKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRS   511
WashU_Scas_Contig714.55   450   TKEIYTAIRQSNNEPTIADIMDDWLLYDSQFSMDNLQILTLQDLLDKDRS   499
WashU_Skud_Contig2043.3   470   TKEIFTAIRQSNNKPTMASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRS   519
Symbols






****:********.**:*.: ********:***:************ .**



SGD_Scer_GIS4/YML006C   513   FPKILFYTMVIVTNSGKQ--VEEEFKN-PNYDNREGISKEQPLDSELSLT   559
MIT_Smik_c567_16380   516   FPKILFYTMVIVTESGQQ--IEEEPKN-PNYGTREDMLKEQPLNSDLLLS   562
MIT_Spar_c187_17356   513   FPKILFYTMVIVTDSSKE--VEEELKN-PNYENREGISKEQPLDSELSLT   559
MIT_Suva_c537_17785   512   FPKILLYTMVIVTNSGQQQIEEENTNL-NQQHREVDLTEEKPPNSELSLS   560
WashU_Sbay_Contig638.5   512   FPKILLYTMVIVTNSGQQQIEEENTNL-NQQHREVDLTEEKPPNSELSLS   560
WashU_Scas_Contig714.55   500   FPKILFYSMVIVTDAHHQPIQGPTSTAGPDLTTSYLSNKLESIAGDETNQ   549
WashU_Skud_Contig2043.3   520   FPKILFYTMVIVTDSGHQQIEEEHKSS-SHRG-TVDTSKEEPLNSELSLS   567
Symbols






*****:*:*****:: :: . . : :. .:



SGD_Scer_GIS4/YML006C   560   NDPQQYFPTAYNNGYN-------DYIDDEDDEDDGDDASLSEQSGPQMYI   602
MIT_Smik_c567_16380   563   HDPKQYFPNAYNNDYD-------EYIDDEDD---DDDASLSEQSGPQMYI   602
MIT_Spar_c187_17356   560   HDPQQYFPTAYNNGYN-------EYIDDEDD---GDDASLSEQSGPQMYI   599
MIT_Suva_c537_17785   561   NDPQRYFPSTFDDDYD-------EYIDDDDG---GDDASLSEQSGPQMYL   600
WashU_Sbay_Contig638.5   561   NDPQRYFPSTFDDDYD-------EYIDDDDG---GDDASLSEQSGPQMYL   600
WashU_Scas_Contig714.55   550   RFENRYYPMADDQVEDQPQQFFPQEDDHDDDNMYDTDDSLMEEAGPEMYL   599
WashU_Skud_Contig2043.3   568   HDPQQYFPTAYNIDYD-------EYTDDEDE---GDDASLSEQSGPQMYL   607
Symbols






. ::*:* : : : : *.:* . * ** *::**:**:



SGD_Scer_GIS4/YML006C   603   PTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKIDKSNSNELDNSKTGE   652
MIT_Smik_c567_16380   603   PTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSNSNESDDSENND   652
MIT_Spar_c187_17356   600   PTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKIDKSNSNELDNSKTGE   649
MIT_Suva_c537_17785   601   PTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSSSNESDNLKECG   650
WashU_Sbay_Contig638.5   601   PTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSSSNESDNLKECG   650
WashU_Scas_Contig714.55   600   PTRMETNNTTAHRSIRTVNSIGEWAFNRNNTNGSSSKSAIGREDED----   645
WashU_Skud_Contig2043.3   608   PTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSDSNELDNSKEGV   657
Symbols






**** :* ********************:*: . .** .. *:



SGD_Scer_GIS4/YML006C   653   STVLSSEPHPMTQLSNSNTTSSNFSHSLKTKNSHKPNSKGNNESNSKNEL   702
MIT_Smik_c567_16380   653   DRLSSDEPYPMTQISNFNTSSSNFSHSLKKKNTSKVNSKINNESNSKSEL   702
MIT_Spar_c187_17356   650   DTISSSEPYPMTQLSDTNTTSSNFSHSLNKKNSFKLNSKGNNESNSKNEL   699
MIT_Suva_c537_17785   651   DRISPVEPYPMTQLSNSNTVTSNFSHLLKNKNSYKRTSKGNNESNSKNEL   700
WashU_Sbay_Contig638.5   651   DRISPVEPYPMTQLSNSNTVTSNFSHLLKNKNSYKRTSKGNNESNSKNEL   700
WashU_Scas_Contig714.55   646   --------------GDEEEETNHHNDGQTHDNNHHHNKKTGKKGSYGGAK   681
WashU_Skud_Contig2043.3   658   NRNSLGEPYPMAQLSNSSTTTSNFNHLLKKKNSYKLGSRDKNGSNSKNEL   707
Symbols






.: . :.:... . .*. : .: : .. .



SGD_Scer_GIS4/YML006C   703   KKIKSSINAMSAVERSKSLPLPTLLKSLSGIDNPTHATNKDRKRWKFQMN   752
MIT_Smik_c567_16380   703   KKIKNSINAMSAVERSKSLPLPTLLKSLSSIDNNTHGTNKDRKRWKFQMN   752
MIT_Spar_c187_17356   700   KKIKSSINAMSAVERSKSLPLPTLLKSLSGIDNHTHGANKDRKRWKFQMN   749
MIT_Suva_c537_17785   701   KKIKTSINAMSAVERSKSLPLPTLLKSLSGMDNHTDSNNKDRKRWKFKMT   750
WashU_Sbay_Contig638.5   701   KKIKTSINAMSAVERSKSLPLPTLLKSLSGMDNHTDSNNKDRKRWKFKMT   750
WashU_Scas_Contig714.55   682   NKRSGNIEAMKAVERTKSTPLPTLLKSISGTG-------TDKKRWKDRLK   724
WashU_Skud_Contig2043.3   708   KKIKTSINAMSAVERSKSLPLPTLLKSLSGIDNHTHGANKDRKRWKFQMN   757
Symbols






:* . .*:**.****:** ********:*. . .*:**** ::.



SGD_Scer_GIS4/YML006C   753   RFKNHKNSGSAGTDKSQRCAIM   774
MIT_Smik_c567_16380   753   RFRNHKNSGSASMDKSQRCVMM   774
MIT_Spar_c187_17356   750   RFRNHKNSGSAGTDKSQRCTIM   771
MIT_Suva_c537_17785   751   RFRNNKNNGSTDIDKSQRCAIM   772
WashU_Sbay_Contig638.5   751   RFRNNKNNGSTDIDKSQRCAIM   772
WashU_Scas_Contig714.55   725   EMKKKNKS---SQEDHSLCNIM   743
WashU_Skud_Contig2043.3   758   RFRNNKNNNSTNTDKSPRCAIM   779
Symbols






.::::::. . :. * :*



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_GIS4/YML006C:

SGD_Scer_GIS4/YML006C  Length: 775  Mon Nov  7 16:12:21 2016  Type: P  Check: 6538  ..

       1  MQKSVRVGDY FDNDDNGLWS WYLTNLRLGD FEELIGNQLK YTLLKRFLNS

      51  HFYGDNNISA RPNKKILLVS IPENVHEDIS ILEIFLKDYF HLEKLEHIQI

     101  SKLTHSHCYN HENHYLLTDN LNNFQDPTFL EFASTSWQVQ KNSKALNNNN

     151  RNSIPPPTIS SSKASNGKLE SNVSDDQWSN INTQTSTATR TNTNTRTLTS

     201  PDTVDINVTS VNSQSNNNDT PQDNENEVDE EDATSSIVLN FSHSRTVDSK

     251  PNRLPKIFPS YTNEDYTPSH SEIMSIDSFA GEDVSSTYPG QDLSLTTARR

     301  EDESGQDEVE DHYSRVSHDL GDESIDQASY SMESSVSYTS YSSSSNSSSA

     351  HYSLSSSSRG NPKRENIDHT NATYVSELSS ITSSIDNLTT STTPEEEDNL

     401  IHHNYDAQGY GSGEDDGEEV YDDEDLSSSD YSVLSILPSI SICDSLGYFR

     451  LVLQSILIQD PDTKEIFTAI RQSNNKPTMA SVTDDWLLYD SNFSMNNLQI

     501  LTLQDLLDIK RSFPKILFYT MVIVTNSGKQ VEEEFKNPNY DNREGISKEQ

     551  PLDSELSLTN DPQQYFPTAY NNGYNDYIDD EDDEDDGDDA SLSEQSGPQM

     601  YIPTRMESNV TTAHRSIRTV NSIGEWAFNR HNSVTKIDKS NSNELDNSKT

     651  GESTVLSSEP HPMTQLSNSN TTSSNFSHSL KTKNSHKPNS KGNNESNSKN

     701  ELKKIKSSIN AMSAVERSKS LPLPTLLKSL SGIDNPTHAT NKDRKRWKFQ

     751  MNRFKNHKNS GSAGTDKSQR CAIM*

Protein Sequence for MIT_Smik_c567_16380:

MIT_Smik_c567_16380  Length: 775  Mon Nov  7 16:12:21 2016  Type: P  Check: 4026  ..

       1  MQKSVRVGDY FDNDDNGLWS WYLTNLRLGD FEELIGNQLK YTLLKRFLNS

      51  HFYGDNSISV RSNKKILLVS IPENVHEDIS ILEIFLKDYF HLEKLEHIQI

     101  SKLTHSHCYN HENHYLLTDN LNNFQDPTFL EFASTSWQVQ KNSKALNNNN

     151  RSLIHPPTIS SSKTSNGQLK SSTSDEQWSN INTQTPTGTR TNTNTRTITS

     201  PDTADICLTS ANRQSNNYAV PQDSENRNDG EDAADDTTSS IVLNFSHSRA

     251  LEPKTSRLPK IFPPYTNEEY TPSHSEIVSI DSFAGEDVSS TYPGQDLSLT

     301  TARCEDDNDQ DDVEGHYNRT SNDLNDKSTN QIRLNMESSV SCTSCSSSSS

     351  SSIRYSLSST SRASLKRESA DHTNATYVSE LSSITSSIDN LTTSTTPEEE

     401  DHLIHHNYDA QGYASREDEV EEVDDDADLS SSDYSVLSIL PSISICDSLG

     451  YFRLVLQSIL IQDPDTKEIF TAIRQSNNRP TIASVTDDWL LYDSNFSMNN

     501  LQILTLQDLL DIKRSFPKIL FYTMVIVTES GQQIEEEPKN PNYGTREDML

     551  KEQPLNSDLL LSHDPKQYFP NAYNNDYDEY IDDEDDDDDA SLSEQSGPQM

     601  YIPTRMESNV TTAHRSIRTV NSIGEWAFNR HNSVTKINKS NSNESDDSEN

     651  NDDRLSSDEP YPMTQISNFN TSSSNFSHSL KKKNTSKVNS KINNESNSKS

     701  ELKKIKNSIN AMSAVERSKS LPLPTLLKSL SSIDNNTHGT NKDRKRWKFQ

     751  MNRFRNHKNS GSASMDKSQR CVMM*

Protein Sequence for MIT_Spar_c187_17356:

MIT_Spar_c187_17356  Length: 772  Mon Nov  7 16:12:21 2016  Type: P  Check: 9504  ..

       1  MQKSVRVGDY FDNDDNGLWS WYLTNLRLGD FEELIGNQLK YTLLKRFLNS

      51  HFYGDNSIWA RPNKKILLVS IPENVHEDIS ILEIFLKDYF HLEKLEHIQI

     101  SKLTHSHCYN HENHYLLTDN LNNFQDPTFL EFASTSWQVQ KNSKALNNNR

     151  NSIQPPPISS SKTSNGKSKP NISDDQWSKK TATATRTNTN TRTLTSPDTV

     201  DINATANGQN NNHDVPQNNN VNENDEEDAG DDATSSIVLN FSHSRTVDPK

     251  PNRLPKIFPS YTNEEYTPSH SEIISIDSFA GEDLSSTYPG QDLSLTTARR

     301  EDENDQDGVE DHYTRVSNDL GDERIDQASS SMESSISCTS CSSSSDSRSA

     351  RYSLSGSSRG SLKHGDADHT NATYVSELSS ITSSIDNLTT STTPEEEDHL

     401  IHRNYDAQGY ASGEDDGEEV YDDEDLSSSD YSVLSILPSI SICDSLGYFR

     451  LVLQSILIQD PDTKEIFTAI RQSNNKPTIA SVTDDWLLYD SNFSMNNLQI

     501  LTLQDLLDIK RSFPKILFYT MVIVTDSSKE VEEELKNPNY ENREGISKEQ

     551  PLDSELSLTH DPQQYFPTAY NNGYNEYIDD EDDGDDASLS EQSGPQMYIP

     601  TRMESNVTTA HRSIRTVNSI GEWAFNRHNS VTKIDKSNSN ELDNSKTGED

     651  TISSSEPYPM TQLSDTNTTS SNFSHSLNKK NSFKLNSKGN NESNSKNELK

     701  KIKSSINAMS AVERSKSLPL PTLLKSLSGI DNHTHGANKD RKRWKFQMNR

     751  FRNHKNSGSA GTDKSQRCTI M*

Protein Sequence for MIT_Suva_c537_17785:

MIT_Suva_c537_17785  Length: 773  Mon Nov  7 16:12:21 2016  Type: P  Check: 5123  ..

       1  MQKSVRVGDY FDNDDNGLWS WYLTNLRLGD FEELIGNQLK YTLLKRFLNS

      51  HFYGDNNTSI RPNKKILLVS IPENVHEDIS ILEIFLKDYF HLEKLEHIQI

     101  SKLTHSHCYN HENHYLLTDY LNNFQDPSFL EFASTSWQVQ KNPKSLNNNN

     151  NRHLIHASTA SSSKPSNAQL KPNTLDDQLL DINTQTSMTA RTNTNTKTLT

     201  YTDTADPSLT QPECNNKGDN DMPQNNENEN EEEDAGDDAA SSIVLNFSHP

     251  RTLASKANRA PKIFPSYTNE DYNPSHSEIV SIDSFAGEDV SSTYPGQDLS

     301  LTTARREDKD DEDRSSNGFD DESFEETSSS IESSVNYTNC SSSSNSSIVR

     351  YHFNSSSRGS LGRGDVDHTN ATYVSELSSI TSSIENVTNS TTPEEEDHLV

     401  RNNYDTREYI SGEEDEEEVD DEEDISSSDY SILSILPSIS ICDSLGYFRL

     451  VLQSILIQNP DTKEIFTAIR QSNNEPTVAS VTDDWLLYDS NFSMNNLQIL

     501  TLQDLLDIKR SFPKILLYTM VIVTNSGQQQ IEEENTNLNQ QHREVDLTEE

     551  KPPNSELSLS NDPQRYFPST FDDDYDEYID DDDGGDDASL SEQSGPQMYL

     601  PTRMASNVTT AHRSIRTVNS IGEWAFNRHN SVTKINKSSS NESDNLKECG

     651  DRISPVEPYP MTQLSNSNTV TSNFSHLLKN KNSYKRTSKG NNESNSKNEL

     701  KKIKTSINAM SAVERSKSLP LPTLLKSLSG MDNHTDSNNK DRKRWKFKMT

     751  RFRNNKNNGS TDIDKSQRCA IM*

Protein Sequence for WashU_Sbay_Contig638.5:

WashU_Sbay_Contig638.5  Length: 773  Mon Nov  7 16:12:21 2016  Type: P  Check: 5123  ..

       1  MQKSVRVGDY FDNDDNGLWS WYLTNLRLGD FEELIGNQLK YTLLKRFLNS

      51  HFYGDNNTSI RPNKKILLVS IPENVHEDIS ILEIFLKDYF HLEKLEHIQI

     101  SKLTHSHCYN HENHYLLTDY LNNFQDPSFL EFASTSWQVQ KNPKSLNNNN

     151  NRHLIHASTA SSSKPSNAQL KPNTLDDQLL DINTQTSMTA RTNTNTKTLT

     201  YTDTADPSLT QPECNNKGDN DMPQNNENEN EEEDAGDDAA SSIVLNFSHP

     251  RTLASKANRA PKIFPSYTNE DYNPSHSEIV SIDSFAGEDV SSTYPGQDLS

     301  LTTARREDKD DEDRSSNGFD DESFEETSSS IESSVNYTNC SSSSNSSIVR

     351  YHFNSSSRGS LGRGDVDHTN ATYVSELSSI TSSIENVTNS TTPEEEDHLV

     401  RNNYDTREYI SGEEDEEEVD DEEDISSSDY SILSILPSIS ICDSLGYFRL

     451  VLQSILIQNP DTKEIFTAIR QSNNEPTVAS VTDDWLLYDS NFSMNNLQIL

     501  TLQDLLDIKR SFPKILLYTM VIVTNSGQQQ IEEENTNLNQ QHREVDLTEE

     551  KPPNSELSLS NDPQRYFPST FDDDYDEYID DDDGGDDASL SEQSGPQMYL

     601  PTRMASNVTT AHRSIRTVNS IGEWAFNRHN SVTKINKSSS NESDNLKECG

     651  DRISPVEPYP MTQLSNSNTV TSNFSHLLKN KNSYKRTSKG NNESNSKNEL

     701  KKIKTSINAM SAVERSKSLP LPTLLKSLSG MDNHTDSNNK DRKRWKFKMT

     751  RFRNNKNNGS TDIDKSQRCA IM*

Protein Sequence for WashU_Scas_Contig714.55:

WashU_Scas_Contig714.55  Length: 744  Mon Nov  7 16:12:21 2016  Type: P  Check: 5476  ..

       1  MQKSVRVTDY FDNDDNGLWS WYLTNIRLGD FEEVTGNQLK YTLLKRFLNS

      51  HFYSNSDVTA TESPQQHNNN NNTNNNNTQQ LKPNFRKILL VSIPDKVHRD

     101  LSILETFLRD YFHLEHLEGI QIQRLTQSKC YNHENHYLLT DTINNFDDPV

     151  FLEFAGSNWQ ARKNLHLNNH LDHRDDDRIS PQSIDTHSAL NKNDDQILVT

     201  QPIDSTLVTP ETREKENLDD IDVGGSSIVL NFSHTREHRK DKDPLNMVKQ

     251  EEQSNKFSPN MMFTPPQSEL VSINSFDDGD SMNYNGHPLK LTLTRQDEES

     301  IAQLEQDKQA EYPTATTTTT ATITATNNNI NNNTYHNLHD HKLTPEESIQ

     351  SYEIGKSSIT DMSSLKRSLN SIGTDSSSSI SRREILNLDR TDIEEGEVDD

     401  RDDEDEDEDI DDLSSDYSVL SILPSISISD AIEGHFRLVL QSILIQHPVT

     451  KEIYTAIRQS NNEPTIADIM DDWLLYDSQF SMDNLQILTL QDLLDKDRSF

     501  PKILFYSMVI VTDAHHQPIQ GPTSTAGPDL TTSYLSNKLE SIAGDETNQR

     551  FENRYYPMAD DQVEDQPQQF FPQEDDHDDD NMYDTDDSLM EEAGPEMYLP

     601  TRMETNNTTA HRSIRTVNSI GEWAFNRNNT NGSSSKSAIG REDEDGDEEE

     651  ETNHHNDGQT HDNNHHHNKK TGKKGSYGGA KNKRSGNIEA MKAVERTKST

     701  PLPTLLKSIS GTGTDKKRWK DRLKEMKKKN KSSQEDHSLC NIM*


Protein Sequence for WashU_Skud_Contig2043.3:

WashU_Skud_Contig2043.3  Length: 780  Mon Nov  7 16:12:21 2016  Type: P  Check: 6155  ..

       1  MQKSVRVGDY FDNDDNGLWS WYLTNLRLGD FEELIGNQLK YTLLKRFLNS

      51  HFYGDYNTSA RPNKKILLVS IPENVHEDIS ILEIFLKDYF HLEKLEHIQI

     101  SKLTHSHCYN HENHYLLTDN LNNFQDPTFL EFASTSWQVQ KNSKTLNNNN

     151  RYLMHGSTIS SSKTSTGQLK PNTLDDQWSN INTQTSTATR TNTNTRTLTS

     201  PDTADLSLTP TNGDNNNNDV LQSNENENAE EDAGEDATSS IVLNFSHSRT

     251  LASKANRLPK ILPSYTNEDY TPSHSEIVSI DSFTGEDASS TYPGQDLSLT

     301  TARREDANDE NDENESEDHY NRNSDGFHDE GNEQVSLGIE SCVSYSSCSS

     351  SSIGSSVRYS LSGNRRDSLR NGNVDHTNAT YVSELSSITS SIDNLTTSTT

     401  PEEEENLVQN NYDAREYISG EEDGEGADED EDISSSDYSV LSILPSISIC

     451  DSLGYFRLVL QSILIQDPDT KEIFTAIRQS NNKPTMASVT DDWLLYDSNF

     501  SMNNLQILTL QDLLDIKRSF PKILFYTMVI VTDSGHQQIE EEHKSSSHRG

     551  TVDTSKEEPL NSELSLSHDP QQYFPTAYNI DYDEYTDDED EGDDASLSEQ

     601  SGPQMYLPTR MASNVTTAHR SIRTVNSIGE WAFNRHNSVT KINKSDSNEL

     651  DNSKEGVNRN SLGEPYPMAQ LSNSSTTTSN FNHLLKKKNS YKLGSRDKNG

     701  SNSKNELKKI KTSINAMSAV ERSKSLPLPT LLKSLSGIDN HTHGANKDRK

     751  RWKFQMNRFR NNKNNNSTNT DKSPRCAIM*