Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YLR450W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_HMG2/YLR450W   1   MSLPLKTIVHLVKPFACTARFSARYPIHVIVVAVLLSAAAYLSVTQSYLN   50
MIT_Smik_c911_15511   1   MSLPLKTIIHLVKPFACTARFSARYPIHVIVVAVLLSAAAYLSVTQSYLN   50
MIT_Spar_c153_15153   1   MSLPLKTIIHLVKPFACTARFSARYPIHVIVVAVLLSAAAYLSVTQSYLN   50
MIT_Suva_c238_17255   1   MSLSLKTIIQLVKPFACTARFSARYPIHVIVIAVLLSAAAYLSVTQSYLN   50
WashU_Sbay_Contig617.11   1   MSLSLKTIIQLVKPFACTARFSARYPIHVIVIAVLLSAAAYLSVTQSYLN   50
WashU_Skud_Contig1639.4   1   MSPPLKTIIHLVKPFACTARLSARYPIHVIVVAVLLSVAAYLSVTQSYLN   50
Symbols






** .****::**********:**********:*****.************



SGD_Scer_HMG2/YLR450W   51   EWKLDSNQYSTYLSIKPDELFEKCTHYYRSPVSDTWKLLSSKEAADIYTP   100
MIT_Smik_c911_15511   51   EWKLDSSQYSTYLSIKPDELFEKCTHYYRSPVSDTWKLLSSKEAADIYTP   100
MIT_Spar_c153_15153   51   EWKLDSNQYSTYLSIKPDELFEKCTHYYRSPVSDTWKLLSSKEAADIYTP   100
MIT_Suva_c238_17255   51   EWKLDSNQYSTYLSIKPDELFERCTHYYRSPVSDTWKLLSSKEAADIYTP   100
WashU_Sbay_Contig617.11   51   EWKLDSNQYSTYLSIKPDELFERCTHYYRSPVSDTWKLLSSKEAADIYTP   100
WashU_Skud_Contig1639.4   51   EWKLDSSQYSTYLSIKPDELFDRSTHYYRSPVSDTWKLLSSKEAADVHTP   100
Symbols






******.**************::.**********************::**



SGD_Scer_HMG2/YLR450W   101   FHYYLSTISFQSKDNSTTLPSLDDVIYSVDHTRYLLSEEPKIPTELVSEN   150
MIT_Smik_c911_15511   101   FHYYLSTINFQSKDNSTTLPSLDDVIYSVDYTRYLLSEEPKIPTELVSEN   150
MIT_Spar_c153_15153   101   FHYYLSTISFQSKDNSTTLPSLDDVIYSVDHTRYLLSEEPKIQTELVSEN   150
MIT_Suva_c238_17255   101   FHYYLSTMSFQTKANSTTLPSLEDVIYSVDHTRYVLSEEPKIPTELISEG   150
WashU_Sbay_Contig617.11   101   FHYYLSTMSFQTKANSTTLPSLEDVIYSVDHTRYVLSEEPKIPTELISEG   150
WashU_Skud_Contig1639.4   101   FHYYLSTISFQSKDNSTTLPSLDDVIYSVDHTRFLLTEEPKILTELISED   150
Symbols






*******:.**:* ********:*******:**::*:***** ***:**.



SGD_Scer_HMG2/YLR450W   151   GTKWRLRNNSNFILDLHNIYRNMVKQFSNKTSEFDQFDLFIILAAYLTLF   200
MIT_Smik_c911_15511   151   GTKWRLRNNSNFILDLHNIYRNFVKQFSNKTSEFDQFDLFIILAAYLTLF   200
MIT_Spar_c153_15153   151   GTKWRLRNNSNFILDLHNIYRNMVKQFSNKTSEFDQFDLFIILAAYFTLF   200
MIT_Suva_c238_17255   151   GTKWRLRSNSNLILDLHNTYRNLVKQFSNKTSEFDQFDLLIILAAYLTLF   200
WashU_Sbay_Contig617.11   151   GTKWRLRSNSNLILDLHNTYRNLVKQFSNKTSEFDQFDLLIILAAYLTLF   200
WashU_Skud_Contig1639.4   151   GTKWRLRNHSNFILDLHNTYRNFVKQFSNKTSEFDQFDLFIILAAYLTLI   200
Symbols






*******.:**:****** ***:****************:******:**:



SGD_Scer_HMG2/YLR450W   201   YTLCCLFNDMRKIGSKFWLSFSALSNSACALYLSLYTTHSLLKKPASLLS   250
MIT_Smik_c911_15511   201   YTLCCLFNDMRKIGSKFWLSFSVLSNSACALYLSLYTTHSLLKKPASLLS   250
MIT_Spar_c153_15153   201   YTLCCLFNDMRKIGSKFWLSFSALSNSACALYLSLYTTHSLLKKPASLLS   250
MIT_Suva_c238_17255   201   YTLCCLFNDMRKIGSKFWLSFSALSNSACALYLSLYTTHTLLKKPASLLS   250
WashU_Sbay_Contig617.11   201   YTLCCLFNDMRKIGSKFWLSFSALSNSACALYLSLYTTHTLLKKPASLLS   250
WashU_Skud_Contig1639.4   201   YTLCCLFNDMRKIGSKFWLSFSALSNSACALYLSLYTTHTLFKKPPSLLS   250
Symbols






**********************.****************:*:***.****



SGD_Scer_HMG2/YLR450W   251   LVIGLPFIVVIIGFKHKVRLAAFSLQKFHRISIDKKITVSNIIYEAMFQE   300
MIT_Smik_c911_15511   251   LIIGLPFIVVIIGFKHKVRLAAFSLQKFHRTSIDKKITVSNIIYEAIFQE   300
MIT_Spar_c153_15153   251   LIIGLPFIVVIIGFKHKVRLAAFSLQKFHRISIDKKITVSNIIYEAMFQE   300
MIT_Suva_c238_17255   251   LIVGLPFIVVIIGFKHKVRLATLSLQKFHRISIDKKVTVSNIIYEAIFQE   300
WashU_Sbay_Contig617.11   251   LIVGLPFIVVIIGFKHKVRLATLSLQKFHRISIDKKVTVSNIIYEAIFQE   300
WashU_Skud_Contig1639.4   251   LIIGLPFIVVIIGFKHKVRLAAFSLQKFHRISIDRKITVSNIIYEAMFQE   300
Symbols






*::******************::******* ***:*:*********:***



SGD_Scer_HMG2/YLR450W   301   GAYLIRDYLFYISSFIGCAIYARHLPGLVNFCILSTFMLVFDLLLSATFY   350
MIT_Smik_c911_15511   301   GAYLIRDYLFYISSFIGCAIYARHLPGLVNFCILSTFMLIFDLVLSATFY   350
MIT_Spar_c153_15153   301   GSYLIRDYLFYISSFVSCAIYARHLPGLVNFCILSTFMLIFDLILSATFY   350
MIT_Suva_c238_17255   301   GTFLIRDYLFYISSFVGCAIYARHLTGLVNFCILATFMLIFDLILSATFY   350
WashU_Sbay_Contig617.11   301   GTFLIRDYLFYISSFVGCAIYARHLTGLVNFCILATFMLIFDLILSATFY   350
WashU_Skud_Contig1639.4   301   GAYLIRDYLFYISSFIGCAIYARHLVGLVNFCILSTFMLIFDLILSATFY   350
Symbols






*::************:.******** ********:****:***:******



SGD_Scer_HMG2/YLR450W   351   SAILSMKLEINIIHRSTVIRQTLEEDGVVPTTADIIYKDETASEPHFLRS   400
MIT_Smik_c911_15511   351   SAILSMKLEINIIHRSTLIRQTLEEDGVIPTTADIIYKDETASEPNFLRS   400
MIT_Spar_c153_15153   351   SAILSMKLEINIIHRSTLIRQTLEEDGVVPTTADIIYKDETASEPHFLRS   400
MIT_Suva_c238_17255   351   SAILSMKLEINIIHRSTLIRQTLEEDGVFPTTADIIYKDETAAEPNFLRS   400
WashU_Sbay_Contig617.11   351   SAILSMKLEINIIHRSTLIRQTLEEDGVFPTTADIIYKDETAAEPNFLRS   400
WashU_Skud_Contig1639.4   351   SAILSMKLEINIIHRSTLIRQTLEEDGVIPTTTNIIYKSETAAEPNFLRS   400
Symbols






*****************:**********.***::****.***:**:****



SGD_Scer_HMG2/YLR450W   401   NVAIILGKASVIGLLLLINLYVFTDKLNATILNTVYFDSTIYSLPNFINY   450
MIT_Smik_c911_15511   401   NVAILLGKASVIGLLLLINLYVFTDKLNATILNTVYFDSTIYSLPNFINH   450
MIT_Spar_c153_15153   401   NVAILLGKASVIGLLLLINLYVFTDKLNATILNTVYFDSTIYSLPNFINY   450
MIT_Suva_c238_17255   401   NVAILIGKASVIGLLLLINLYVFTDKLNDTILNTVYFDSTIYTLPNFINY   450
WashU_Sbay_Contig617.11   401   NVAILIGKASVIGLLLLINLYVFTDKLNDTILNTVYFDSTIYTLPNFINY   450
WashU_Skud_Contig1639.4   401   NVAIILGKASVIGLLLLINLYVFTDKLNATILDTVYFDSSIYSLPNFINY   450
Symbols






****::********************** ***:******:**:******:



SGD_Scer_HMG2/YLR450W   451   KDIGNLSNQVIISVLPKQYYTPLKKYHQIEDSVLLIIDSVSNAIRDQFIS   500
MIT_Smik_c911_15511   451   KDIGNLSNQVIISVLPKQYYTPLKKYHQIEDSVLVVIDSVSNAIRDQFIS   500
MIT_Spar_c153_15153   451   KDIGNLSNQVIISVLPKQYYTPLKKYHQIEDSVLLIIDSVSNAIRDQFIS   500
MIT_Suva_c238_17255   451   KDIGNLSNQVIISVLPKQYYTPLKKYHQIEDSILLVIDSVSNAIRDQFIS   500
WashU_Sbay_Contig617.11   451   KDIGNLSNQVIISVLPKQYYTPLKKYHQIEDSILLVIDSVSNAIRDQFIS   500
WashU_Skud_Contig1639.4   451   KDIGNLRNQVIISILPKQYYTPLKKYHQIEDSILLIIDSVSNAIRDQFIS   500
Symbols






****** ******:******************:*::**************



SGD_Scer_HMG2/YLR450W   501   KLLFFAFAVSISINVYLLNAAKIHTGYMNFQPQSNKIDDLVVQQKSATIE   550
MIT_Smik_c911_15511   501   KLLFFAFAVSISINIYLLNAAKIHTGYMNLQQQPKKIEDLVVQN-PATFE   549
MIT_Spar_c153_15153   501   KLLFFAFAVSISINVYLLNAAKIHTGYMNFQPQSKKIDDLVVVQKSATIE   550
MIT_Suva_c238_17255   501   KLLFFAFAVSISINIYLLNAAKIHTGYMNFEPQSKKEDDSLKQK-STTIE   549
WashU_Sbay_Contig617.11   501   KLLFFAFAVSISINIYLLNAAKIHTGYMNFEPQSKKEDDSLKQK-STTIE   549
WashU_Skud_Contig1639.4   501   KLLFFAFAVSISVNVYLLNAAKIHTGYMNFQPRPNNIHDDLGQP-SATIE   549
Symbols






************:*:**************:: :.:: .* : .:*:*



SGD_Scer_HMG2/YLR450W   551   FSETRSMPASSGLETPVTAKDIIISEEIQNNECVYALSSQDEPIRPLSNL   600
MIT_Smik_c911_15511   550   FSEIQSVPASSELEISMTANDISVSQEVQNNECFYALSSQDEPIRPLSNL   599
MIT_Spar_c153_15153   551   FSETQSVPASSGLETSVTARDIAISEEIQNNECVYALSFQDEPIRPLSNL   600
MIT_Suva_c238_17255   550   FSDTQSTPVSSGLETPITAKNISISQEIQSNECIYALSSQDEPIRPLSNL   599
WashU_Sbay_Contig617.11   550   FSDTQSTPVSSGLETPITAKNISISQEIQSNECIYALSSQDEPIRPLSNL   599
WashU_Skud_Contig1639.4   550   FSETQSVPASSGLETPVTAKDISISQKIQNDECIYALSPEDEPIRPLSNL   599
Symbols






**: :* *.** ** .:**.:* :*:::*.:**.**** :**********



SGD_Scer_HMG2/YLR450W   601   VELMEKEQLKNMNNTEVSNLVVNGKLPLYSLEKKLEDTTRAVLVRRKALS   650
MIT_Smik_c911_15511   600   VELMEKEQLKNLNNTEVSNLVVNGKLPLYSLEKKLEDTTRAVLVRRKALS   649
MIT_Spar_c153_15153   601   VELMDKEQLKNMNNTEVSDLVVNGKLPLYSLEKKLEDTTRAVLVRRKALS   650
MIT_Suva_c238_17255   600   VELMEDEQLKTLNNTELSDLVVNGRLPLYALEKKLDDTTRAVLVRRKALS   649
WashU_Sbay_Contig617.11   600   VELMEDEQLKTLNNTELSDLVVNGRLPLYALEKKLDDTTRAVLVRRKALS   649
WashU_Skud_Contig1639.4   600   VELMEENQLKNLNNTEVSNLVVNGKLPLYSLEKKLEDTTRAVLVRRKALS   649
Symbols






****:.:***.:****:*:*****:****:*****:**************



SGD_Scer_HMG2/YLR450W   651   TLAESPILVSEKLPFRNYDYDRVFGACCENVIGYMPIPVGVIGPLIIDGT   700
MIT_Smik_c911_15511   650   VLAESPILVSEKLPFRNYDYDRVFGACCENVIGYMPVPVGVIGPLIIDGT   699
MIT_Spar_c153_15153   651   ALAESPILVSEKLPFRNYDYDRVFGACCENVIGYMPIPVGVIGPLIIDGT   700
MIT_Suva_c238_17255   650   VLAESPVLVSEKLPFRNFDYDRVFGACCENVIGYMPIPVGVIGPLIIDGA   699
WashU_Sbay_Contig617.11   650   VLAESPVLVSEKLPFRNFDYDRVFGACCENVIGYMPIPVGVIGPLIIDGA   699
WashU_Skud_Contig1639.4   650   ILAESPVLDSEKLPFRDYDYDRVFGACCENVIGYMPVPVGVIGPLIIDGT   699
Symbols






*****:* *******::******************:************:



SGD_Scer_HMG2/YLR450W   701   SYHIPMATTEGCLVASAMRGCKAINAGGGATTVLTKDGMTRGPVVRFPTL   750
MIT_Smik_c911_15511   700   SYHIPMATTEGCLVASAMRGCKAINAGGGATTVLTKDGMTRGPVVRFPTL   749
MIT_Spar_c153_15153   701   SYHIPMATTEGCLVASAMRGCKAINAGGGATTVLTKDGMTRGPVVRFPTL   750
MIT_Suva_c238_17255   700   SYHIPMATTEGCLVASAMRGCKAINAGGGATTVLTKDGMTRGPVVRFPTL   749
WashU_Sbay_Contig617.11   700   SYHIPMATTEGCLVASAMRGCKAINAGGGATTVLTKDGMTRGPVVRFPTL   749
WashU_Skud_Contig1639.4   700   SYHIPMATTEGCLVASAMRGCKAINAGGGATTVLTKDGMTRGPVVRFPTL   749
Symbols






**************************************************



SGD_Scer_HMG2/YLR450W   751   IRSGACKIWLDSEEGQNSIKKAFNSTSRFARLQHIQTCLAGDLLFMRFRT   800
MIT_Smik_c911_15511   750   IRSGACKIWLDSEEGQNTIKKAFNSTSRFARLQHIQTCLAGDLLFMRFRT   799
MIT_Spar_c153_15153   751   KRSGACKIWLDSEEGQNAIKKAFNSTSRFARLQHIQTCLAGDLLFMRFRT   800
MIT_Suva_c238_17255   750   IRSGACKIWLDSEEGQNIIKKAFNSTSRFARLQHIQTCLAGDLLFMRFRT   799
WashU_Sbay_Contig617.11   750   IRSGACKIWLDSEEGQNIIKKAFNSTSRFARLQHIQTCLAGDLLFMRFRT   799
WashU_Skud_Contig1639.4   750   IRSGACKIWLDSEEGQNTIKKAFNSTSRFARLQHIQTCLAGDLLFMRFRT   799
Symbols






**************** ********************************



SGD_Scer_HMG2/YLR450W   801   TTGDAMGMNMISKGVEYSLKQMVEEYGWEDMEVVSVSGNYCTDKKPAAIN   850
MIT_Smik_c911_15511   800   TTGDAMGMNMISKGVEYSLKQMVEEYGWEDMEVVSVSGNYCTDKKPAAIN   849
MIT_Spar_c153_15153   801   TTGDAMGMNMISKGVEYSLKQMVEEYGWEDMEVVSVSGNYCTDKKPAAIN   850
MIT_Suva_c238_17255   800   TTGDAMGMNMISKGVEYSLKQMVEEYGWNDMEVVSVSGNYCTDKKPAAIN   849
WashU_Sbay_Contig617.11   800   TTGDAMGMNMISKGVEYSLKQMVEEYGWNDMEVVSVSGNYCTDKKPAAIN   849
WashU_Skud_Contig1639.4   800   TTGDAMGMNMISKGVEYSLKQMVEEYGWEDMEVVSVSGNYCTDKKPAAIN   849
Symbols






****************************:*********************



SGD_Scer_HMG2/YLR450W   851   WIEGRGKSVVAEATIPGDVVKSVLKSDVSALVELNISKNLVGSAMAGSVG   900
MIT_Smik_c911_15511   850   WIEGRGKSVVAEATIPGDVVKNVLKSDVAALVELNISKNLVGSAMAGSVG   899
MIT_Spar_c153_15153   851   WIEGRGKSVVAEATIPGDVVKSVLKSDVAALVELNISKNLVGSAMAGSVG   900
MIT_Suva_c238_17255   850   WIEGRGKSVVAEATIPGDVVRSVLKSDVAALVELNIAKNLVGSAMAGSVG   899
WashU_Sbay_Contig617.11   850   WIEGRGKSVVAEATIPGDVVRSVLKSDVAALVELNIAKNLVGSAMAGSVG   899
WashU_Skud_Contig1639.4   850   WMEGRGKSVVAEATIPGDVVKSVLKSDAAPLVELTICKNLVGSAMAGSVG   899
Symbols






*:******************:.*****.:.****.*.*************



SGD_Scer_HMG2/YLR450W   901   GFNAHAANLVTALFLALGQDPAQNVESSNCITLMKEVDGDLRISVSMPSI   950
MIT_Smik_c911_15511   900   GFNAHAANLVTALFMALGQDPAQNVESSNCITLMKEVDGDLRISVSMPSI   949
MIT_Spar_c153_15153   901   GFNAHAANLVTALFLALGQDPAQNVESSNCITLMKEVDGDLRISVSMPSI   950
MIT_Suva_c238_17255   900   GFNAHAANLVTALFLALGQDPAQNVESSNCITLMKEVDGNLRISVSMPSI   949
WashU_Sbay_Contig617.11   900   GFNAHAANLVTALFLALGQDPAQNVESSNCITLMKEVDGNLRISVSMPSI   949
WashU_Skud_Contig1639.4   900   GFNAHAANLVTALFLALGQDPAQNIESSNCISLMKEVDGDLRISVSMPSI   949
Symbols






**************:*********:******:*******:**********



SGD_Scer_HMG2/YLR450W   951   EVGTIGGGTVLEPQGAMLDLLGVRGPHPTEPGANARQLARIIACAVLAGE   1000
MIT_Smik_c911_15511   950   EVGTIGGGTVLEPQGAMLDLLGVRGPHPTEPGANARQLARIIACAVLAGE   999
MIT_Spar_c153_15153   951   EVGTIGGGTVLEPQGAMLDLLGVRGPHPTEPGANARQLARIIACAVLAGE   1000
MIT_Suva_c238_17255   950   EVGTIGGGTVLEPQGAMLDLLGVRGPHPTEPGANARQLARIIACAVLAGE   999
WashU_Sbay_Contig617.11   950   EVGTIGGGTVLEPQGAMLDLLGVRGPHPTEPGANARQLARIIACAVLAGE   999
WashU_Skud_Contig1639.4   950   EVGTIGGGTVLEPQGAMLDLLGVRGPHPTEPGTNARQLARIVACAVLAGE   999
Symbols






********************************:********:********



SGD_Scer_HMG2/YLR450W   1001   LSLCSALAAGHLVQSHMTHNRKTNKANELPQPSNKGPPCKTSALL   1045
MIT_Smik_c911_15511   1000   LSLCSALAAGHLVQSHMAHNRKTNKTSEQPLPSDKGSSL------   1038
MIT_Spar_c153_15153   1001   LSLCSALAAGHLVQSHMTHNRKTNRANESPQPSNGGPPS------   1039
MIT_Suva_c238_17255   1000   LSLCSALAAGHLVQSHMTHNRKTNKTNEQQQSSTITPPL------   1038
WashU_Sbay_Contig617.11   1000   LSLCSALAAGHLVQSHMTHNRKTNKTNEQQQSSTITPPL------   1038
WashU_Skud_Contig1639.4   1000   LSLCSALAAGHLVQSHMTHNRKANKINEQQKLSDTNPSL------   1038
Symbols






*****************:****:*: .* * ..



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_HMG2/YLR450W:

SGD_Scer_HMG2/YLR450W  Length: 1046  Mon Nov  7 16:11:49 2016  Type: P  Check: 6277  ..

       1  MSLPLKTIVH LVKPFACTAR FSARYPIHVI VVAVLLSAAA YLSVTQSYLN

      51  EWKLDSNQYS TYLSIKPDEL FEKCTHYYRS PVSDTWKLLS SKEAADIYTP

     101  FHYYLSTISF QSKDNSTTLP SLDDVIYSVD HTRYLLSEEP KIPTELVSEN

     151  GTKWRLRNNS NFILDLHNIY RNMVKQFSNK TSEFDQFDLF IILAAYLTLF

     201  YTLCCLFNDM RKIGSKFWLS FSALSNSACA LYLSLYTTHS LLKKPASLLS

     251  LVIGLPFIVV IIGFKHKVRL AAFSLQKFHR ISIDKKITVS NIIYEAMFQE

     301  GAYLIRDYLF YISSFIGCAI YARHLPGLVN FCILSTFMLV FDLLLSATFY

     351  SAILSMKLEI NIIHRSTVIR QTLEEDGVVP TTADIIYKDE TASEPHFLRS

     401  NVAIILGKAS VIGLLLLINL YVFTDKLNAT ILNTVYFDST IYSLPNFINY

     451  KDIGNLSNQV IISVLPKQYY TPLKKYHQIE DSVLLIIDSV SNAIRDQFIS

     501  KLLFFAFAVS ISINVYLLNA AKIHTGYMNF QPQSNKIDDL VVQQKSATIE

     551  FSETRSMPAS SGLETPVTAK DIIISEEIQN NECVYALSSQ DEPIRPLSNL

     601  VELMEKEQLK NMNNTEVSNL VVNGKLPLYS LEKKLEDTTR AVLVRRKALS

     651  TLAESPILVS EKLPFRNYDY DRVFGACCEN VIGYMPIPVG VIGPLIIDGT

     701  SYHIPMATTE GCLVASAMRG CKAINAGGGA TTVLTKDGMT RGPVVRFPTL

     751  IRSGACKIWL DSEEGQNSIK KAFNSTSRFA RLQHIQTCLA GDLLFMRFRT

     801  TTGDAMGMNM ISKGVEYSLK QMVEEYGWED MEVVSVSGNY CTDKKPAAIN

     851  WIEGRGKSVV AEATIPGDVV KSVLKSDVSA LVELNISKNL VGSAMAGSVG

     901  GFNAHAANLV TALFLALGQD PAQNVESSNC ITLMKEVDGD LRISVSMPSI

     951  EVGTIGGGTV LEPQGAMLDL LGVRGPHPTE PGANARQLAR IIACAVLAGE

    1001  LSLCSALAAG HLVQSHMTHN RKTNKANELP QPSNKGPPCK TSALL*


Protein Sequence for MIT_Smik_c911_15511:

MIT_Smik_c911_15511  Length: 1039  Mon Nov  7 16:11:49 2016  Type: P  Check: 5997  ..

       1  MSLPLKTIIH LVKPFACTAR FSARYPIHVI VVAVLLSAAA YLSVTQSYLN

      51  EWKLDSSQYS TYLSIKPDEL FEKCTHYYRS PVSDTWKLLS SKEAADIYTP

     101  FHYYLSTINF QSKDNSTTLP SLDDVIYSVD YTRYLLSEEP KIPTELVSEN

     151  GTKWRLRNNS NFILDLHNIY RNFVKQFSNK TSEFDQFDLF IILAAYLTLF

     201  YTLCCLFNDM RKIGSKFWLS FSVLSNSACA LYLSLYTTHS LLKKPASLLS

     251  LIIGLPFIVV IIGFKHKVRL AAFSLQKFHR TSIDKKITVS NIIYEAIFQE

     301  GAYLIRDYLF YISSFIGCAI YARHLPGLVN FCILSTFMLI FDLVLSATFY

     351  SAILSMKLEI NIIHRSTLIR QTLEEDGVIP TTADIIYKDE TASEPNFLRS

     401  NVAILLGKAS VIGLLLLINL YVFTDKLNAT ILNTVYFDST IYSLPNFINH

     451  KDIGNLSNQV IISVLPKQYY TPLKKYHQIE DSVLVVIDSV SNAIRDQFIS

     501  KLLFFAFAVS ISINIYLLNA AKIHTGYMNL QQQPKKIEDL VVQNPATFEF

     551  SEIQSVPASS ELEISMTAND ISVSQEVQNN ECFYALSSQD EPIRPLSNLV

     601  ELMEKEQLKN LNNTEVSNLV VNGKLPLYSL EKKLEDTTRA VLVRRKALSV

     651  LAESPILVSE KLPFRNYDYD RVFGACCENV IGYMPVPVGV IGPLIIDGTS

     701  YHIPMATTEG CLVASAMRGC KAINAGGGAT TVLTKDGMTR GPVVRFPTLI

     751  RSGACKIWLD SEEGQNTIKK AFNSTSRFAR LQHIQTCLAG DLLFMRFRTT

     801  TGDAMGMNMI SKGVEYSLKQ MVEEYGWEDM EVVSVSGNYC TDKKPAAINW

     851  IEGRGKSVVA EATIPGDVVK NVLKSDVAAL VELNISKNLV GSAMAGSVGG

     901  FNAHAANLVT ALFMALGQDP AQNVESSNCI TLMKEVDGDL RISVSMPSIE

     951  VGTIGGGTVL EPQGAMLDLL GVRGPHPTEP GANARQLARI IACAVLAGEL

    1001  SLCSALAAGH LVQSHMAHNR KTNKTSEQPL PSDKGSSL*

Protein Sequence for MIT_Spar_c153_15153:

MIT_Spar_c153_15153  Length: 1040  Mon Nov  7 16:11:49 2016  Type: P  Check: 7475  ..

       1  MSLPLKTIIH LVKPFACTAR FSARYPIHVI VVAVLLSAAA YLSVTQSYLN

      51  EWKLDSNQYS TYLSIKPDEL FEKCTHYYRS PVSDTWKLLS SKEAADIYTP

     101  FHYYLSTISF QSKDNSTTLP SLDDVIYSVD HTRYLLSEEP KIQTELVSEN

     151  GTKWRLRNNS NFILDLHNIY RNMVKQFSNK TSEFDQFDLF IILAAYFTLF

     201  YTLCCLFNDM RKIGSKFWLS FSALSNSACA LYLSLYTTHS LLKKPASLLS

     251  LIIGLPFIVV IIGFKHKVRL AAFSLQKFHR ISIDKKITVS NIIYEAMFQE

     301  GSYLIRDYLF YISSFVSCAI YARHLPGLVN FCILSTFMLI FDLILSATFY

     351  SAILSMKLEI NIIHRSTLIR QTLEEDGVVP TTADIIYKDE TASEPHFLRS

     401  NVAILLGKAS VIGLLLLINL YVFTDKLNAT ILNTVYFDST IYSLPNFINY

     451  KDIGNLSNQV IISVLPKQYY TPLKKYHQIE DSVLLIIDSV SNAIRDQFIS

     501  KLLFFAFAVS ISINVYLLNA AKIHTGYMNF QPQSKKIDDL VVVQKSATIE

     551  FSETQSVPAS SGLETSVTAR DIAISEEIQN NECVYALSFQ DEPIRPLSNL

     601  VELMDKEQLK NMNNTEVSDL VVNGKLPLYS LEKKLEDTTR AVLVRRKALS

     651  ALAESPILVS EKLPFRNYDY DRVFGACCEN VIGYMPIPVG VIGPLIIDGT

     701  SYHIPMATTE GCLVASAMRG CKAINAGGGA TTVLTKDGMT RGPVVRFPTL

     751  KRSGACKIWL DSEEGQNAIK KAFNSTSRFA RLQHIQTCLA GDLLFMRFRT

     801  TTGDAMGMNM ISKGVEYSLK QMVEEYGWED MEVVSVSGNY CTDKKPAAIN

     851  WIEGRGKSVV AEATIPGDVV KSVLKSDVAA LVELNISKNL VGSAMAGSVG

     901  GFNAHAANLV TALFLALGQD PAQNVESSNC ITLMKEVDGD LRISVSMPSI

     951  EVGTIGGGTV LEPQGAMLDL LGVRGPHPTE PGANARQLAR IIACAVLAGE

    1001  LSLCSALAAG HLVQSHMTHN RKTNRANESP QPSNGGPPS*

Protein Sequence for MIT_Suva_c238_17255:

MIT_Suva_c238_17255  Length: 1039  Mon Nov  7 16:11:49 2016  Type: P  Check: 6296  ..

       1  MSLSLKTIIQ LVKPFACTAR FSARYPIHVI VIAVLLSAAA YLSVTQSYLN

      51  EWKLDSNQYS TYLSIKPDEL FERCTHYYRS PVSDTWKLLS SKEAADIYTP

     101  FHYYLSTMSF QTKANSTTLP SLEDVIYSVD HTRYVLSEEP KIPTELISEG

     151  GTKWRLRSNS NLILDLHNTY RNLVKQFSNK TSEFDQFDLL IILAAYLTLF

     201  YTLCCLFNDM RKIGSKFWLS FSALSNSACA LYLSLYTTHT LLKKPASLLS

     251  LIVGLPFIVV IIGFKHKVRL ATLSLQKFHR ISIDKKVTVS NIIYEAIFQE

     301  GTFLIRDYLF YISSFVGCAI YARHLTGLVN FCILATFMLI FDLILSATFY

     351  SAILSMKLEI NIIHRSTLIR QTLEEDGVFP TTADIIYKDE TAAEPNFLRS

     401  NVAILIGKAS VIGLLLLINL YVFTDKLNDT ILNTVYFDST IYTLPNFINY

     451  KDIGNLSNQV IISVLPKQYY TPLKKYHQIE DSILLVIDSV SNAIRDQFIS

     501  KLLFFAFAVS ISINIYLLNA AKIHTGYMNF EPQSKKEDDS LKQKSTTIEF

     551  SDTQSTPVSS GLETPITAKN ISISQEIQSN ECIYALSSQD EPIRPLSNLV

     601  ELMEDEQLKT LNNTELSDLV VNGRLPLYAL EKKLDDTTRA VLVRRKALSV

     651  LAESPVLVSE KLPFRNFDYD RVFGACCENV IGYMPIPVGV IGPLIIDGAS

     701  YHIPMATTEG CLVASAMRGC KAINAGGGAT TVLTKDGMTR GPVVRFPTLI

     751  RSGACKIWLD SEEGQNIIKK AFNSTSRFAR LQHIQTCLAG DLLFMRFRTT

     801  TGDAMGMNMI SKGVEYSLKQ MVEEYGWNDM EVVSVSGNYC TDKKPAAINW

     851  IEGRGKSVVA EATIPGDVVR SVLKSDVAAL VELNIAKNLV GSAMAGSVGG

     901  FNAHAANLVT ALFLALGQDP AQNVESSNCI TLMKEVDGNL RISVSMPSIE

     951  VGTIGGGTVL EPQGAMLDLL GVRGPHPTEP GANARQLARI IACAVLAGEL

    1001  SLCSALAAGH LVQSHMTHNR KTNKTNEQQQ SSTITPPL*

Protein Sequence for WashU_Sbay_Contig617.11:

WashU_Sbay_Contig617.11  Length: 1039  Mon Nov  7 16:11:49 2016  Type: P  Check: 6296  ..

       1  MSLSLKTIIQ LVKPFACTAR FSARYPIHVI VIAVLLSAAA YLSVTQSYLN

      51  EWKLDSNQYS TYLSIKPDEL FERCTHYYRS PVSDTWKLLS SKEAADIYTP

     101  FHYYLSTMSF QTKANSTTLP SLEDVIYSVD HTRYVLSEEP KIPTELISEG

     151  GTKWRLRSNS NLILDLHNTY RNLVKQFSNK TSEFDQFDLL IILAAYLTLF

     201  YTLCCLFNDM RKIGSKFWLS FSALSNSACA LYLSLYTTHT LLKKPASLLS

     251  LIVGLPFIVV IIGFKHKVRL ATLSLQKFHR ISIDKKVTVS NIIYEAIFQE

     301  GTFLIRDYLF YISSFVGCAI YARHLTGLVN FCILATFMLI FDLILSATFY

     351  SAILSMKLEI NIIHRSTLIR QTLEEDGVFP TTADIIYKDE TAAEPNFLRS

     401  NVAILIGKAS VIGLLLLINL YVFTDKLNDT ILNTVYFDST IYTLPNFINY

     451  KDIGNLSNQV IISVLPKQYY TPLKKYHQIE DSILLVIDSV SNAIRDQFIS

     501  KLLFFAFAVS ISINIYLLNA AKIHTGYMNF EPQSKKEDDS LKQKSTTIEF

     551  SDTQSTPVSS GLETPITAKN ISISQEIQSN ECIYALSSQD EPIRPLSNLV

     601  ELMEDEQLKT LNNTELSDLV VNGRLPLYAL EKKLDDTTRA VLVRRKALSV

     651  LAESPVLVSE KLPFRNFDYD RVFGACCENV IGYMPIPVGV IGPLIIDGAS

     701  YHIPMATTEG CLVASAMRGC KAINAGGGAT TVLTKDGMTR GPVVRFPTLI

     751  RSGACKIWLD SEEGQNIIKK AFNSTSRFAR LQHIQTCLAG DLLFMRFRTT

     801  TGDAMGMNMI SKGVEYSLKQ MVEEYGWNDM EVVSVSGNYC TDKKPAAINW

     851  IEGRGKSVVA EATIPGDVVR SVLKSDVAAL VELNIAKNLV GSAMAGSVGG

     901  FNAHAANLVT ALFLALGQDP AQNVESSNCI TLMKEVDGNL RISVSMPSIE

     951  VGTIGGGTVL EPQGAMLDLL GVRGPHPTEP GANARQLARI IACAVLAGEL

    1001  SLCSALAAGH LVQSHMTHNR KTNKTNEQQQ SSTITPPL*

Protein Sequence for WashU_Skud_Contig1639.4:

WashU_Skud_Contig1639.4  Length: 1039  Mon Nov  7 16:11:49 2016  Type: P  Check: 5341  ..

       1  MSPPLKTIIH LVKPFACTAR LSARYPIHVI VVAVLLSVAA YLSVTQSYLN

      51  EWKLDSSQYS TYLSIKPDEL FDRSTHYYRS PVSDTWKLLS SKEAADVHTP

     101  FHYYLSTISF QSKDNSTTLP SLDDVIYSVD HTRFLLTEEP KILTELISED

     151  GTKWRLRNHS NFILDLHNTY RNFVKQFSNK TSEFDQFDLF IILAAYLTLI

     201  YTLCCLFNDM RKIGSKFWLS FSALSNSACA LYLSLYTTHT LFKKPPSLLS

     251  LIIGLPFIVV IIGFKHKVRL AAFSLQKFHR ISIDRKITVS NIIYEAMFQE

     301  GAYLIRDYLF YISSFIGCAI YARHLVGLVN FCILSTFMLI FDLILSATFY

     351  SAILSMKLEI NIIHRSTLIR QTLEEDGVIP TTTNIIYKSE TAAEPNFLRS

     401  NVAIILGKAS VIGLLLLINL YVFTDKLNAT ILDTVYFDSS IYSLPNFINY

     451  KDIGNLRNQV IISILPKQYY TPLKKYHQIE DSILLIIDSV SNAIRDQFIS

     501  KLLFFAFAVS ISVNVYLLNA AKIHTGYMNF QPRPNNIHDD LGQPSATIEF

     551  SETQSVPASS GLETPVTAKD ISISQKIQND ECIYALSPED EPIRPLSNLV

     601  ELMEENQLKN LNNTEVSNLV VNGKLPLYSL EKKLEDTTRA VLVRRKALSI

     651  LAESPVLDSE KLPFRDYDYD RVFGACCENV IGYMPVPVGV IGPLIIDGTS

     701  YHIPMATTEG CLVASAMRGC KAINAGGGAT TVLTKDGMTR GPVVRFPTLI

     751  RSGACKIWLD SEEGQNTIKK AFNSTSRFAR LQHIQTCLAG DLLFMRFRTT

     801  TGDAMGMNMI SKGVEYSLKQ MVEEYGWEDM EVVSVSGNYC TDKKPAAINW

     851  MEGRGKSVVA EATIPGDVVK SVLKSDAAPL VELTICKNLV GSAMAGSVGG

     901  FNAHAANLVT ALFLALGQDP AQNIESSNCI SLMKEVDGDL RISVSMPSIE

     951  VGTIGGGTVL EPQGAMLDLL GVRGPHPTEP GTNARQLARI VACAVLAGEL

    1001  SLCSALAAGH LVQSHMTHNR KANKINEQQK LSDTNPSL*