Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YLR287C-A and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_RPS30A/YLR287C-A   1   -----------------MAKVHGSLARAGKVKSQTPKVEKTEKPKKPKGR   33
MIT_Spar_c147_15777   1   MIHYTNMFINFNINMFIQAKVHGSLARAGKVKSQTPKVEKTEKPKKPKGR   50
WashU_Sklu_Contig2217.3   1   ----MNGLLTINS---VQAKVHGSLSRAGKVKSQTPKVEKQEKPKQPKGR   43
Symbols






*******:************** ****:****



SGD_Scer_RPS30A/YLR287C-A   34   AYKRLLYTRRFVNVTLVNGKRRMNPGPSVQ   63
MIT_Spar_c147_15777   51   AYKRLLYTRRFVNVTLVNGKRRMNPGPSVQ   80
WashU_Sklu_Contig2217.3   44   AYKRLLYTRRFVNVTLTNGKRKMNPSPSSQ   73
Symbols






****************.****:***.** *



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_RPS30A/YLR287C-A:

SGD_Scer_RPS30A/YLR287C-A  Length: 64  Mon Nov  7 16:08:01 2016  Type: P  Check: 2008  ..

       1  MAKVHGSLAR AGKVKSQTPK VEKTEKPKKP KGRAYKRLLY TRRFVNVTLV

      51  NGKRRMNPGP SVQ*

Protein Sequence for MIT_Spar_c147_15777:

MIT_Spar_c147_15777  Length: 81  Mon Nov  7 16:08:01 2016  Type: P  Check: 448  ..

       1  MIHYTNMFIN FNINMFIQAK VHGSLARAGK VKSQTPKVEK TEKPKKPKGR

      51  AYKRLLYTRR FVNVTLVNGK RRMNPGPSVQ *

Protein Sequence for WashU_Sklu_Contig2217.3:

WashU_Sklu_Contig2217.3  Length: 74  Mon Nov  7 16:08:01 2016  Type: P  Check: 1516  ..

       1  MNGLLTINSV QAKVHGSLSR AGKVKSQTPK VEKQEKPKQP KGRAYKRLLY

      51  TRRFVNVTLT NGKRKMNPSP SSQ*