Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YLR131C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_ACE2/YLR131C   1   ---MDNVVDPWYINPSGFAKDTQDEEYVQHHDNVNPTIPPPDNYILNNEN   47
MIT_Smik_c1476_14820   1   ---MDNVADPWYISSSGFVKDLQDEDYNQHPDNVNANIPQSENYPLNNDN   47
MIT_Spar_c42_14324   1   ---MDNVVDPWYINPSGFAKDIQDEEYAQHHDNVDPTIPQADNYPSNNEN   47
MIT_Suva_c138_16206   1   ---MDNIADPWYINPSGLVKNPEDGEFSQHNG----NVHQSGSYPLNSEG   43
WashU_Sbay_Contig571.8   1   ---MDNIADPWYINPSGLVKNPEDGEFSQHNG----NVHQSGSYPLNSEG   43
WashU_Scas_Contig713.52   1   MEQPLPQESWGQLNPADLLNNPNDNNVTDMYLNTSALPNRGQDYKLQQLD   50
WashU_Sklu_Contig2172.4   1   MYPPDELGNIYDLQPTDMVPKSN-----------------GNSIPLPNED   33
WashU_Smik_Contig2848.8   1   ---MDNVADPWYISSSGFVKDLQDEDYNQHPDNVNANIPQSENYPLNNDN   47
Symbols






. :..:.: . : . . .



SGD_Scer_ACE2/YLR131C   48   DDGLDNLLGMDYYNIDDLLTQELRDLDIPLVPSPKTGDGSSDKKNIDRTW   97
MIT_Smik_c1476_14820   48   ANGLDNLIGMDYYNIDDLLTQELRDLDIPLVPSPRAGDDLCDKKNMDSAW   97
MIT_Spar_c42_14324   48   DDGLDNLLGMDYYNIDDLLTQELRDLDIPLVPSPKTGDDPRDKKSIDRTW   97
MIT_Suva_c138_16206   44   AEGLDNFLGMDYYNIDDLLTQELRDLDIPIVPSPRIGDDPNDKNNIERSW   93
WashU_Sbay_Contig571.8   44   AEGLDNFLGMDYYNIDDLLTQELRDLDIPIVPSPRIGDDPNDKNNIERSW   93
WashU_Scas_Contig713.52   51   DDAFNDLFDSNYSNIDNLLSQELKDLDIPLIP----LNNNNDNDNFNWNQ   96
WashU_Sklu_Contig2172.4   34   ---FTNLYSKDYDDVDGFLTQELRDLDIPMIP-------QVDVDNNDMNF   73
WashU_Smik_Contig2848.8   48   ANGLDNLIGMDYYNIDDLLTQELRDLDIPLVPSPRAGDDLCDKKNMDSAW   97
Symbols






: :: . :* ::*.:*:***:*****::* * .. :



SGD_Scer_ACE2/YLR131C   98   NLGDENNKVSHYSKKSMSSHKRGLSGTAIFGFLGHNKTLSISSLQQSILN   147
MIT_Smik_c1476_14820   98   SFGDDNNKFSHYSKKSMSSHKRGLSGTAIFGFLGHNKTLSISSLQQSILN   147
MIT_Spar_c42_14324   98   NFGDENNKISHYSKKSMSSHKRGLSGTAIFGFLGHNKTLSVSSLQQSILN   147
MIT_Suva_c138_16206   94   NFVSDNNKSSHYGKKSMSSHKRGLSGTAIFGFLGHNKTLSISSLQQSILN   143
WashU_Sbay_Contig571.8   94   NFVSDNNKSSHYGKKSMSSHKRGLSGTAIFGFLGHNKTLSISSLQQSILN   143
WashU_Scas_Contig713.52   97   LSLDMNNNNTHQYNKSMSSHKRGPSGTAIFGFLNHNKNLSISSNQQNFLD   146
WashU_Sklu_Contig2172.4   74   LTSVNYWNNADSVSTPRKSHARGPSGTAIFGFSGHNKTLSISSIQKTIDP   123
WashU_Smik_Contig2848.8   98   SFGDDNNKFSHYSKKSMSSHKRGLSGTAIFGFLGHNKTLSISSLQQSILN   147
Symbols






: :. ... .** ** ******** .***.**:** *:.:



SGD_Scer_ACE2/YLR131C   148   MSKDPQPMELINELGNHNTVKNNNDDFDHIRENDGENSYLSQVLLKQQEE   197
MIT_Smik_c1476_14820   148   MSKDPQPMELINEFK-TQTAKANNEDFAQIREKDGENSYLSQVLLKQQEE   196
MIT_Spar_c42_14324   148   MSKDPQPMDLINELG-NHTVKHNNHDFDHIREKDGENSYLSQVLLKQQEE   196
MIT_Suva_c138_16206   144   MSKDPQPMGLINEGD-NHTSRHNNEDFAQIEENDGENNHLSQVLLKQQEE   192
WashU_Sbay_Contig571.8   144   MSKDPQPMGLINEGD-NHTSRHNNEDFAQIEENDGENNHLSQVLLKQQEE   192
WashU_Scas_Contig713.52   147   LSRDPNLAAMNASMKDTATTTTPN-------------AMISQTLFKQQEE   183
WashU_Sklu_Contig2172.4   124   AQTTTKCQQQLQRDT-MPFLNTENSTVEGHYNTSKQDGTLNTVILKQQEE   172
WashU_Smik_Contig2848.8   148   MSKDPQPMELINEFK-TQTAKANNEDFAQIREKDGENSYLSQVLLKQQEE   196
Symbols






. .: * :. .::*****



SGD_Scer_ACE2/YLR131C   198   LRIALEKQKEVNEKLEKQLRDNQIQQEKLRKVLEEQEEVAQKLVSGATNS   247
MIT_Smik_c1476_14820   197   LRIALEKQKEVNEKLEKQLRDNQLQQEKLRRVLEEQEEVAQKLVSGTAKS   246
MIT_Spar_c42_14324   197   LRIALEKQKEVNEKLEKQLRDNQLQQEKLRRVLEEQEEVAQKLVSETAKS   246
MIT_Suva_c138_16206   193   LRIALERQKEVNEKLEKQLRDNQVQQEKLRKVLEEQEEVAQKLVSRTANS   242
WashU_Sbay_Contig571.8   193   LRIALERQKEVNEKLEKQLRDNQVQQEKLRKVLEEQEEVAQKLVSRTANS   242
WashU_Scas_Contig713.52   184   LRLALEQQKEVNKKLELQLRENQLQQEKLQKVLMEQEMVAQQLVQNSS--   231
WashU_Sklu_Contig2172.4   173   LRLALERQKEMNRQLEEQLRQNQLQQQQLQKALHNQEFVTHQISVNSS--   220
WashU_Smik_Contig2848.8   197   LRIALEKQKEVNEKLEKQLRDNQLQQEKLRRVLEEQEEVAQKLVSGTAKS   246
Symbols






**:***:***:*.:** ***:**:**::*::.* :** *:::: ::



SGD_Scer_ACE2/YLR131C   248   NSKPGSPVILKTPAMQNGRMKDNAIIVTTNSANGGYQFPPPTLISP----   293
MIT_Smik_c1476_14820   247   NSKPGSPVILKTPAMQNSRTKDNAIIVTTNSANGGYQFPPPTLISP----   292
MIT_Spar_c42_14324   247   NSKPGSPVILKTPAMQNSRSKDNAIIVTTNSANGGYQFPPPTLISP----   292
MIT_Suva_c138_16206   243   NSKCESPVTLRTPAAQTNRTKDNAIIVTTNSANGGYQFPPPAVISP----   288
WashU_Sbay_Contig571.8   243   NSKCESPVTLRTPAAQTNRTKDNAIIVTTNSANGGYQFPPPAVISP----   288
WashU_Scas_Contig713.52   232   SPPPPQQGYNTPSSKIRKNPADDALIVTSNSMNGKYQFPPPSMVSP----   277
WashU_Sklu_Contig2172.4   221   --------PTKTPSSRINKQDDRNMIVTSNSASGGYQFPPPSMGRSDRNN   262
WashU_Smik_Contig2848.8   247   NSKPGSPVILKTPAMQNSRTKDNAIIVTTNSANGGYQFPPPTLISP----   292
Symbols






..: . * :***:** .* ******:: .



SGD_Scer_ACE2/YLR131C   294   ----------RMSNTSINGSPSRKYHRQRYPNKSPESNGLNLFSSNSGYL   333
MIT_Smik_c1476_14820   293   ----------PMSNTSMNGSPSRKYRRNRYPNKSPESNELNLFPSNSAYL   332
MIT_Spar_c42_14324   293   ----------PISNTSINGSPSRKYHRQRYPNKSPESNGLNLFSSNSGYL   332
MIT_Suva_c138_16206   289   ----------PISNTSINGSPSRKYHRQRYSNKSPESNGLNLFSSNSAYL   328
WashU_Sbay_Contig571.8   289   ----------PISNTSINGSPSRKYHRQRYSNKSPESNGLNLFSSNSAYL   328
WashU_Scas_Contig713.52   278   ----------PMSTASMDGSPMRRGRSQMRPR---LQNSPTTTSSRNNDT   314
WashU_Sklu_Contig2172.4   263   SGSTIYGMISPMSGTSVNGSPSRKTQR-VRAQMINAQGGLQLVKENSGSP   311
WashU_Smik_Contig2848.8   293   ----------PMSNTSMNGSPSRKYRRNRYPNKSPESNELNLFPSNSAYL   332
Symbols






:* :*::*** *: : .. .. ...



SGD_Scer_ACE2/YLR131C   334   RDSELLSFSPQNYNLNLDGLTYNDHNNTSDKNNNDKKNSTGDNIFRLFEK   383
MIT_Smik_c1476_14820   
   --------------------------------------------------   
MIT_Spar_c42_14324   333   RDSELLSFSPPNYNLSMCGLAYDDHNNTSDKNDNDKRNNTGDNIFRLFEK   382
MIT_Suva_c138_16206   329   RTSELLSFSPPNYNLNMDGLSYNDNNN-----NNDKRDNGSNNISQLFGK   373
WashU_Sbay_Contig571.8   329   RTSELLSFSPPNYNLNMDGLSYNDNNN-----NNDKRDNGSNNISQLFGK   373
WashU_Scas_Contig713.52   315   SPENLLATTNYFQRLNDE--------------------------------   332
WashU_Sklu_Contig2172.4   312   QDSADLSGSYRNS-------------------------------------   324
WashU_Smik_Contig2848.8   333   RDSELLSFSPQNYDLNMNTLAYDYEYNNRDKNDNSKRINTGDNISRLFEK   382
Symbols










SGD_Scer_ACE2/YLR131C   384   TSPGGLSISPRINGNSLRSPFLVGTDKSRDDRYAAGTFTPRTQLSPIHKK   433
MIT_Smik_c1476_14820   
   --------------------------------------------------   
MIT_Spar_c42_14324   383   TSPGGLSISPRINGNSLRSPFLVNADRSKDDRYATSTFTSRTQLSPIHKK   432
MIT_Suva_c138_16206   374   TSPGGLGVSPRLSSNNLRSPFLLNSDKGRDEQYDSSTLTARTQLSPSHRK   423
WashU_Sbay_Contig571.8   374   TSPGGLGVSPRLSSNNLRSPFLLNSDKGRDEQYDSSTLTARTQLSPSHRK   423
WashU_Scas_Contig713.52   333   -----RSFPDALNSPLYVPPPPPAPLKDISSFHPLTPRTQLTHHSPFHNK   377
WashU_Sklu_Contig2172.4   325   ------TNNPPISSLQKISKYFPNMDVSTQEADALFHLRPRRRSG-----   363
WashU_Smik_Contig2848.8   383   TSPGEISTSPRISGNGLRSPFLLIADKNRDDRYLASTFTHRTQLSPIHKK   432
Symbols










SGD_Scer_ACE2/YLR131C   434   RESVVSTVSTISQLQDDTEPIHMRNTQNPTLRNANALASSSVLPPIPGSS   483
MIT_Smik_c1476_14820   
   --------------------------------------------------   
MIT_Spar_c42_14324   433   RESVVSTVSTISQLQDDIEPIHMRNTQSPMVKNGNALPSSSVLPPIPGST   482
MIT_Suva_c138_16206   424   KESAISTVSTIPQLQDDTEPPHMRNNQSPTARDENNLPSSNMLPPIPGSS   473
WashU_Sbay_Contig571.8   424   KESAISTVSTIPQLQDDTEPPHMRNNQSPTARDENNLPSSNMLPPIPGSS   473
WashU_Scas_Contig713.52   378   KDSVISTVSTIPQDENDTPSPEQ--------------PHFNILPTIPGSS   413
WashU_Sklu_Contig2172.4   
   --------------------------------------------------   
WashU_Smik_Contig2848.8   433   RESAVSTVSTISQLQDDTEPIHMRNTQIPMARNGNALPSSTILPPIPGSS   482
Symbols










SGD_Scer_ACE2/YLR131C   484   NNTPIKNSLPQKHVFQHTPVKAP----PKNGSNLAPLLNAPDLTDHQLEI   529
MIT_Smik_c1476_14820   
   --------------------------------------------------   
MIT_Spar_c42_14324   483   NNTPIKNSLPQKHLFQHTPIKTL----TKDGNSLDPLLNAPDLTDRQLEI   528
MIT_Suva_c138_16206   474   NNTPIKSSLPQKHLFQHTPIKIQNQTLPKNGHNLGSLLNAPDLTQHQLEI   523
WashU_Sbay_Contig571.8   474   NNTPIKSSLPQKHLFQHTPIKIQNQTLPKNGHNLGSLLNAPDLTQHQLEI   523
WashU_Scas_Contig713.52   414   ENTPQKS--------------------------------NPTTTNHYLPQ   431
WashU_Sklu_Contig2172.4   
   --------------------------------------------------   
WashU_Smik_Contig2848.8   483   NNTPIKTSLPQKHIFQHTPVKVL----PKDRNNLDPLLNAPDLTEHQLEI   528
Symbols










SGD_Scer_ACE2/YLR131C   530   KTPIRNNSHCEVESYPQVPPVTHDIHKSPTLHSTSPLPDEIIPRTTPMKI   579
MIT_Smik_c1476_14820   
   --------------------------------------------------   
MIT_Spar_c42_14324   529   KTPIRSNSHGEEESYPQAPPVTHDIHKSPTLDITSPPPGEIIPRTTPMKI   578
MIT_Suva_c138_16206   524   KTPMQHNSHNGDENYTRPRPSARGMHTSPTLDMTPPPPEEIISRTTPMKI   573
WashU_Sbay_Contig571.8   524   KTPMQHNSHNGDENYTRPRPSARGMHTSPTLDMTPPPPEEIISRTTPMKI   573
WashU_Scas_Contig713.52   432   KHTFQHNTPVKQQQRTP-------------------------IKTSPTRI   456
WashU_Sklu_Contig2172.4   364   -------------------------------------------GTGPITP   370
WashU_Smik_Contig2848.8   529   KTPIRRDSQNEMDCRTRAPPIARNPHKSPTLDITPPPPGEIIPRTSPMKI   578
Symbols










SGD_Scer_ACE2/YLR131C   580   TKKPTTLPPGTIDQYVKELPDKLFECLYPNCNKVFKRRYNIRSHIQTHLQ   629
MIT_Smik_c1476_14820   
   --------------------------------------------------   
MIT_Spar_c42_14324   579   TKKPTTLPPGTIDQYVKELPDKLFECLYPNCSKVFKRRYNIRSHIQTHLQ   628
MIT_Suva_c138_16206   574   TKKPTTLPPGTIDQYVKELPDKLFECLYPNCSKVFKRRYNIRSHIQTHLQ   623
WashU_Sbay_Contig571.8   574   TKKPTTLPPGTIDQYVKELPDKLFECLYPNCSKVFKRRYNIRSHIQTHLQ   623
WashU_Scas_Contig713.52   457   TNKPSTLPRGTIDLYVKELPDKLFECLYEDCGKIFKRRYNVRSHIQTHLE   506
WashU_Sklu_Contig2172.4   371   QDQILVGPSPSLNIHRNKRGESTVSTPTSSASTIPQFQD-----------   409
WashU_Smik_Contig2848.8   579   TKKPTTLPPGTIDQYVKELPDKLFECLYPNCSKVFKRRYNIRSHIQTHLQ   628
Symbols










SGD_Scer_ACE2/YLR131C   630   DRPYSCDFPGCTKAFVRNHDLIRHKISHNAKKYICPCGKRFNREDALMVH   679
MIT_Smik_c1476_14820   
   --------------------------------------------------   
MIT_Spar_c42_14324   629   DRPYSCDFPGCTKAFVRNHDLIRHKISHNAKKYICPCGKRFNREDALMVH   678
MIT_Suva_c138_16206   624   DRPYSCDFPSCDKAFVRNHDLIRHKISHNAKKYVCPCGKRFNREDALMVH   673
WashU_Sbay_Contig571.8   624   DRPYSCDFPSCDKAFVRNHDLIRHKISHNAKKYVCPCGKRFNREDALMVH   673
WashU_Scas_Contig713.52   507   DKPYACDFPGCEKAFVRNHDLVRHKKSHANR-------------------   537
WashU_Sklu_Contig2172.4   
   --------------------------------------------------   
WashU_Smik_Contig2848.8   629   DRPYACDFPGCAKAFVRNHDLIRHKISHNAKKFICPCGKRFNREDALMVH   678
Symbols










SGD_Scer_ACE2/YLR131C   680   RSRMICTGGKKLEHSINKKLTSPKKSLLDSPHDTSPVKETIARDKDGSVL   729
MIT_Smik_c1476_14820   
   --------------------------------------------------   
MIT_Spar_c42_14324   679   RSRMICTGGKKLEHSISKKLTSPKKSHLDSPYETSPVKETIARDKDGSVL   728
MIT_Suva_c138_16206   674   RSRMICTGGKKLEHFISKKLTSPKRSGFGSPHETSPVKETIVRDKDGSVI   723
WashU_Sbay_Contig571.8   674   RSRMICTGGKKLEHFISKKLTSPKRSGFGSPHETSPVKETIVRDKDGSVI   723
WashU_Scas_Contig713.52   538   ------------TSSPQKRVQKDHSNEGTQSNNTSPVKEAIQRDKDGSIM   575
WashU_Sklu_Contig2172.4   410   --------------------------------DDSDVDTLPVRTKVEGLG   427
WashU_Smik_Contig2848.8   679   RSRMVCTGGKKLEHSISKKHISPKKSLLDSPYETSPVKETIARDKDGSVL   728
Symbols










SGD_Scer_ACE2/YLR131C   730   MKMEEQLRDDMRKHGLLDPPPSTAAHEQNSNRTLSNETDAL----   770
MIT_Smik_c1476_14820   
   ---------------------------------------------   
MIT_Spar_c42_14324   729   MKMEEQLRDDMRKHGLLDPPPSRATYEQNSSLTPSNESDSL----   769
MIT_Suva_c138_16206   724   MRMEEQLRNDMREHGLLDPPPSTAEYEQSPRLTPFNDRDEF----   764
WashU_Sbay_Contig571.8   724   MRMEEQLRNDMREHGLLDPPPSTAEYEQSPRLTPFNDRDEF----   764
WashU_Scas_Contig713.52   576   LKMQDQLRDEMEKYGFLRPPSSAANTNLVLTPSPERVPPSLYSSD   620
WashU_Sklu_Contig2172.4   428   IRFKTNDNHKQRQKYTLNKPPLLDLLPPIPGSTDNTPMGKGNX--   470
WashU_Smik_Contig2848.8   729   MKMEQQLRDDMRKHGLLDPPPSTAPYEKNPSPTPSNESVGL----   769
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_ACE2/YLR131C:

SGD_Scer_ACE2/YLR131C  Length: 771  Mon Nov  7 16:04:48 2016  Type: P  Check: 7456  ..

       1  MDNVVDPWYI NPSGFAKDTQ DEEYVQHHDN VNPTIPPPDN YILNNENDDG

      51  LDNLLGMDYY NIDDLLTQEL RDLDIPLVPS PKTGDGSSDK KNIDRTWNLG

     101  DENNKVSHYS KKSMSSHKRG LSGTAIFGFL GHNKTLSISS LQQSILNMSK

     151  DPQPMELINE LGNHNTVKNN NDDFDHIREN DGENSYLSQV LLKQQEELRI

     201  ALEKQKEVNE KLEKQLRDNQ IQQEKLRKVL EEQEEVAQKL VSGATNSNSK

     251  PGSPVILKTP AMQNGRMKDN AIIVTTNSAN GGYQFPPPTL ISPRMSNTSI

     301  NGSPSRKYHR QRYPNKSPES NGLNLFSSNS GYLRDSELLS FSPQNYNLNL

     351  DGLTYNDHNN TSDKNNNDKK NSTGDNIFRL FEKTSPGGLS ISPRINGNSL

     401  RSPFLVGTDK SRDDRYAAGT FTPRTQLSPI HKKRESVVST VSTISQLQDD

     451  TEPIHMRNTQ NPTLRNANAL ASSSVLPPIP GSSNNTPIKN SLPQKHVFQH

     501  TPVKAPPKNG SNLAPLLNAP DLTDHQLEIK TPIRNNSHCE VESYPQVPPV

     551  THDIHKSPTL HSTSPLPDEI IPRTTPMKIT KKPTTLPPGT IDQYVKELPD

     601  KLFECLYPNC NKVFKRRYNI RSHIQTHLQD RPYSCDFPGC TKAFVRNHDL

     651  IRHKISHNAK KYICPCGKRF NREDALMVHR SRMICTGGKK LEHSINKKLT

     701  SPKKSLLDSP HDTSPVKETI ARDKDGSVLM KMEEQLRDDM RKHGLLDPPP

     751  STAAHEQNSN RTLSNETDAL *

Protein Sequence for MIT_Smik_c1476_14820:

MIT_Smik_c1476_14820  Length: 332  Mon Nov  7 16:04:48 2016  Type: P  Check: 9582  ..

       1  MDNVADPWYI SSSGFVKDLQ DEDYNQHPDN VNANIPQSEN YPLNNDNANG

      51  LDNLIGMDYY NIDDLLTQEL RDLDIPLVPS PRAGDDLCDK KNMDSAWSFG

     101  DDNNKFSHYS KKSMSSHKRG LSGTAIFGFL GHNKTLSISS LQQSILNMSK

     151  DPQPMELINE FKTQTAKANN EDFAQIREKD GENSYLSQVL LKQQEELRIA

     201  LEKQKEVNEK LEKQLRDNQL QQEKLRRVLE EQEEVAQKLV SGTAKSNSKP

     251  GSPVILKTPA MQNSRTKDNA IIVTTNSANG GYQFPPPTLI SPPMSNTSMN

     301  GSPSRKYRRN RYPNKSPESN ELNLFPSNSA YL

Protein Sequence for MIT_Spar_c42_14324:

MIT_Spar_c42_14324  Length: 770  Mon Nov  7 16:04:48 2016  Type: P  Check: 3126  ..

       1  MDNVVDPWYI NPSGFAKDIQ DEEYAQHHDN VDPTIPQADN YPSNNENDDG

      51  LDNLLGMDYY NIDDLLTQEL RDLDIPLVPS PKTGDDPRDK KSIDRTWNFG

     101  DENNKISHYS KKSMSSHKRG LSGTAIFGFL GHNKTLSVSS LQQSILNMSK

     151  DPQPMDLINE LGNHTVKHNN HDFDHIREKD GENSYLSQVL LKQQEELRIA

     201  LEKQKEVNEK LEKQLRDNQL QQEKLRRVLE EQEEVAQKLV SETAKSNSKP

     251  GSPVILKTPA MQNSRSKDNA IIVTTNSANG GYQFPPPTLI SPPISNTSIN

     301  GSPSRKYHRQ RYPNKSPESN GLNLFSSNSG YLRDSELLSF SPPNYNLSMC

     351  GLAYDDHNNT SDKNDNDKRN NTGDNIFRLF EKTSPGGLSI SPRINGNSLR

     401  SPFLVNADRS KDDRYATSTF TSRTQLSPIH KKRESVVSTV STISQLQDDI

     451  EPIHMRNTQS PMVKNGNALP SSSVLPPIPG STNNTPIKNS LPQKHLFQHT

     501  PIKTLTKDGN SLDPLLNAPD LTDRQLEIKT PIRSNSHGEE ESYPQAPPVT

     551  HDIHKSPTLD ITSPPPGEII PRTTPMKITK KPTTLPPGTI DQYVKELPDK

     601  LFECLYPNCS KVFKRRYNIR SHIQTHLQDR PYSCDFPGCT KAFVRNHDLI

     651  RHKISHNAKK YICPCGKRFN REDALMVHRS RMICTGGKKL EHSISKKLTS

     701  PKKSHLDSPY ETSPVKETIA RDKDGSVLMK MEEQLRDDMR KHGLLDPPPS

     751  RATYEQNSSL TPSNESDSL*

Protein Sequence for MIT_Suva_c138_16206:

MIT_Suva_c138_16206  Length: 765  Mon Nov  7 16:04:48 2016  Type: P  Check: 7433  ..

       1  MDNIADPWYI NPSGLVKNPE DGEFSQHNGN VHQSGSYPLN SEGAEGLDNF

      51  LGMDYYNIDD LLTQELRDLD IPIVPSPRIG DDPNDKNNIE RSWNFVSDNN

     101  KSSHYGKKSM SSHKRGLSGT AIFGFLGHNK TLSISSLQQS ILNMSKDPQP

     151  MGLINEGDNH TSRHNNEDFA QIEENDGENN HLSQVLLKQQ EELRIALERQ

     201  KEVNEKLEKQ LRDNQVQQEK LRKVLEEQEE VAQKLVSRTA NSNSKCESPV

     251  TLRTPAAQTN RTKDNAIIVT TNSANGGYQF PPPAVISPPI SNTSINGSPS

     301  RKYHRQRYSN KSPESNGLNL FSSNSAYLRT SELLSFSPPN YNLNMDGLSY

     351  NDNNNNNDKR DNGSNNISQL FGKTSPGGLG VSPRLSSNNL RSPFLLNSDK

     401  GRDEQYDSST LTARTQLSPS HRKKESAIST VSTIPQLQDD TEPPHMRNNQ

     451  SPTARDENNL PSSNMLPPIP GSSNNTPIKS SLPQKHLFQH TPIKIQNQTL

     501  PKNGHNLGSL LNAPDLTQHQ LEIKTPMQHN SHNGDENYTR PRPSARGMHT

     551  SPTLDMTPPP PEEIISRTTP MKITKKPTTL PPGTIDQYVK ELPDKLFECL

     601  YPNCSKVFKR RYNIRSHIQT HLQDRPYSCD FPSCDKAFVR NHDLIRHKIS

     651  HNAKKYVCPC GKRFNREDAL MVHRSRMICT GGKKLEHFIS KKLTSPKRSG

     701  FGSPHETSPV KETIVRDKDG SVIMRMEEQL RNDMREHGLL DPPPSTAEYE

     751  QSPRLTPFND RDEF*

Protein Sequence for WashU_Sbay_Contig571.8:

WashU_Sbay_Contig571.8  Length: 765  Mon Nov  7 16:04:48 2016  Type: P  Check: 7433  ..

       1  MDNIADPWYI NPSGLVKNPE DGEFSQHNGN VHQSGSYPLN SEGAEGLDNF

      51  LGMDYYNIDD LLTQELRDLD IPIVPSPRIG DDPNDKNNIE RSWNFVSDNN

     101  KSSHYGKKSM SSHKRGLSGT AIFGFLGHNK TLSISSLQQS ILNMSKDPQP

     151  MGLINEGDNH TSRHNNEDFA QIEENDGENN HLSQVLLKQQ EELRIALERQ

     201  KEVNEKLEKQ LRDNQVQQEK LRKVLEEQEE VAQKLVSRTA NSNSKCESPV

     251  TLRTPAAQTN RTKDNAIIVT TNSANGGYQF PPPAVISPPI SNTSINGSPS

     301  RKYHRQRYSN KSPESNGLNL FSSNSAYLRT SELLSFSPPN YNLNMDGLSY

     351  NDNNNNNDKR DNGSNNISQL FGKTSPGGLG VSPRLSSNNL RSPFLLNSDK

     401  GRDEQYDSST LTARTQLSPS HRKKESAIST VSTIPQLQDD TEPPHMRNNQ

     451  SPTARDENNL PSSNMLPPIP GSSNNTPIKS SLPQKHLFQH TPIKIQNQTL

     501  PKNGHNLGSL LNAPDLTQHQ LEIKTPMQHN SHNGDENYTR PRPSARGMHT

     551  SPTLDMTPPP PEEIISRTTP MKITKKPTTL PPGTIDQYVK ELPDKLFECL

     601  YPNCSKVFKR RYNIRSHIQT HLQDRPYSCD FPSCDKAFVR NHDLIRHKIS

     651  HNAKKYVCPC GKRFNREDAL MVHRSRMICT GGKKLEHFIS KKLTSPKRSG

     701  FGSPHETSPV KETIVRDKDG SVIMRMEEQL RNDMREHGLL DPPPSTAEYE

     751  QSPRLTPFND RDEF*

Protein Sequence for WashU_Scas_Contig713.52:

WashU_Scas_Contig713.52  Length: 621  Mon Nov  7 16:04:48 2016  Type: P  Check: 9610  ..

       1  MEQPLPQESW GQLNPADLLN NPNDNNVTDM YLNTSALPNR GQDYKLQQLD

      51  DDAFNDLFDS NYSNIDNLLS QELKDLDIPL IPLNNNNDND NFNWNQLSLD

     101  MNNNNTHQYN KSMSSHKRGP SGTAIFGFLN HNKNLSISSN QQNFLDLSRD

     151  PNLAAMNASM KDTATTTTPN AMISQTLFKQ QEELRLALEQ QKEVNKKLEL

     201  QLRENQLQQE KLQKVLMEQE MVAQQLVQNS SSPPPPQQGY NTPSSKIRKN

     251  PADDALIVTS NSMNGKYQFP PPSMVSPPMS TASMDGSPMR RGRSQMRPRL

     301  QNSPTTTSSR NNDTSPENLL ATTNYFQRLN DERSFPDALN SPLYVPPPPP

     351  APLKDISSFH PLTPRTQLTH HSPFHNKKDS VISTVSTIPQ DENDTPSPEQ

     401  PHFNILPTIP GSSENTPQKS NPTTTNHYLP QKHTFQHNTP VKQQQRTPIK

     451  TSPTRITNKP STLPRGTIDL YVKELPDKLF ECLYEDCGKI FKRRYNVRSH

     501  IQTHLEDKPY ACDFPGCEKA FVRNHDLVRH KKSHANRTSS PQKRVQKDHS

     551  NEGTQSNNTS PVKEAIQRDK DGSIMLKMQD QLRDEMEKYG FLRPPSSAAN

     601  TNLVLTPSPE RVPPSLYSSD *

Protein Sequence for WashU_Sklu_Contig2172.4:

WashU_Sklu_Contig2172.4  Length: 470  Mon Nov  7 16:04:48 2016  Type: P  Check: 7470  ..

       1  MYPPDELGNI YDLQPTDMVP KSNGNSIPLP NEDFTNLYSK DYDDVDGFLT

      51  QELRDLDIPM IPQVDVDNND MNFLTSVNYW NNADSVSTPR KSHARGPSGT

     101  AIFGFSGHNK TLSISSIQKT IDPAQTTTKC QQQLQRDTMP FLNTENSTVE

     151  GHYNTSKQDG TLNTVILKQQ EELRLALERQ KEMNRQLEEQ LRQNQLQQQQ

     201  LQKALHNQEF VTHQISVNSS PTKTPSSRIN KQDDRNMIVT SNSASGGYQF

     251  PPPSMGRSDR NNSGSTIYGM ISPMSGTSVN GSPSRKTQRV RAQMINAQGG

     301  LQLVKENSGS PQDSADLSGS YRNSTNNPPI SSLQKISKYF PNMDVSTQEA

     351  DALFHLRPRR RSGGTGPITP QDQILVGPSP SLNIHRNKRG ESTVSTPTSS

     401  ASTIPQFQDD DSDVDTLPVR TKVEGLGIRF KTNDNHKQRQ KYTLNKPPLL

     451  DLLPPIPGST DNTPMGKGNX

Protein Sequence for WashU_Smik_Contig2848.8:

WashU_Smik_Contig2848.8  Length: 770  Mon Nov  7 16:04:48 2016  Type: P  Check: 1639  ..

       1  MDNVADPWYI SSSGFVKDLQ DEDYNQHPDN VNANIPQSEN YPLNNDNANG

      51  LDNLIGMDYY NIDDLLTQEL RDLDIPLVPS PRAGDDLCDK KNMDSAWSFG

     101  DDNNKFSHYS KKSMSSHKRG LSGTAIFGFL GHNKTLSISS LQQSILNMSK

     151  DPQPMELINE FKTQTAKANN EDFAQIREKD GENSYLSQVL LKQQEELRIA

     201  LEKQKEVNEK LEKQLRDNQL QQEKLRRVLE EQEEVAQKLV SGTAKSNSKP

     251  GSPVILKTPA MQNSRTKDNA IIVTTNSANG GYQFPPPTLI SPPMSNTSMN

     301  GSPSRKYRRN RYPNKSPESN ELNLFPSNSA YLRDSELLSF SPQNYDLNMN

     351  TLAYDYEYNN RDKNDNSKRI NTGDNISRLF EKTSPGEIST SPRISGNGLR

     401  SPFLLIADKN RDDRYLASTF THRTQLSPIH KKRESAVSTV STISQLQDDT

     451  EPIHMRNTQI PMARNGNALP SSTILPPIPG SSNNTPIKTS LPQKHIFQHT

     501  PVKVLPKDRN NLDPLLNAPD LTEHQLEIKT PIRRDSQNEM DCRTRAPPIA

     551  RNPHKSPTLD ITPPPPGEII PRTSPMKITK KPTTLPPGTI DQYVKELPDK

     601  LFECLYPNCS KVFKRRYNIR SHIQTHLQDR PYACDFPGCA KAFVRNHDLI

     651  RHKISHNAKK FICPCGKRFN REDALMVHRS RMVCTGGKKL EHSISKKHIS

     701  PKKSLLDSPY ETSPVKETIA RDKDGSVLMK MEQQLRDDMR KHGLLDPPPS

     751  TAPYEKNPSP TPSNESVGL*