Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YLL013C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_PUF3/YLL013C   1   ----------------MEMNMDMDMDMELASIVSSLSALSHSNNNGGQAA   34
MIT_Smik_c1210_14353   1   --------------------MDMDMDMELASIVSSLSALSNGNNNGS--Q   28
MIT_Spar_c52_14884   1   ------------------MEMDMDMDMELASIVSSLSALSNGNNNGG--Q   30
MIT_Suva_c529_15556   
   --------------------------------------------------   
WashU_Sbay_Contig566.3   1   --------------------------MELASIVSSLSALSNGNNNGG--Q   22
WashU_Scas_Contig688.28   1   --MTILNALDPWLDRNSHDNGSNTQPQHQSQMDAELASIVSSLSALS---   45
WashU_Sklu_Contig2097.2   1   MSTTGHPSADPWSSFDYKSTRPSKMDSELASIVSSLSALSNPSAQHG---   47
Symbols










SGD_Scer_PUF3/YLL013C   35   AAGIVNGGAAGSQQIGGFRRSSFTTANEVDSEILLLHGSSESSPIFKKTA   84
MIT_Smik_c1210_14353   29   ATAIVGSATAGSQQIGGFRRSSFTTSNDIDSDILLLHGSSESSPIFKKTA   78
MIT_Spar_c52_14884   31   AGAIVSGSAAGSQQIGGFRRSSFTTANEVDSEILLLHGSSESSPIFKKTA   80
MIT_Suva_c529_15556   
   --------------------------------------------------   
WashU_Sbay_Contig566.3   23   AAAVVGGAAAGSQQIGGFRRSSFTTSNDIDSDILLLHGSSESSPIFKKTA   72
WashU_Scas_Contig688.28   46   ASNNIANANSQAQQIGGFRRSSFNQ---SDIDSEILLLNNNQNQTRNTLS   92
WashU_Sklu_Contig2097.2   48   QPHQLSQAQGHQGQLGGFRRPSINSNNGSDVESEILFQNQTSPVLRRTTL   97
Symbols










SGD_Scer_PUF3/YLL013C   85   LSVGTAPPFSTNSKKFFGNGGNYYQYRSTDTASLSSASYNNYHTHHTAAN   134
MIT_Smik_c1210_14353   79   LSVGTAPPFSTNSKKFFGNGSNYYHYRSNDTSSLSSASHNNYQTHNAAGN   128
MIT_Spar_c52_14884   81   LSVGTAPPFSTNSKKFFGNGGNYYQYRSNDTASLSSTSYSNYHTHHAAGN   130
MIT_Suva_c529_15556   
   --------------------------------------------------   
WashU_Sbay_Contig566.3   73   LSVGTAPPFSTNSKKFFGNNSNYYQYRSNDTASLSSASYNNYQTNNAAGN   122
WashU_Scas_Contig688.28   93   VGAAPNYYNQQQANIYSPSS-------SDSSPPPQFPAPFPHVSKSINDI   135
WashU_Sklu_Contig2097.2   98   SVGG--------ASVGAPNG-------VNN--------------------   112
Symbols










SGD_Scer_PUF3/YLL013C   135   LGKNNKVNHLLGQYSASIAGPVYYNGN--DNNNSGGEGFFEKFGKSLIDG   182
MIT_Smik_c1210_14353   129   LGKNNKVNHLLGQYSASIAGPVYYNGN--ENNNSGGEGFFEKFGKSLIDG   176
MIT_Spar_c52_14884   131   LGKNNKVNHLLGQYSASIAGPVYYNGN--DNSNSGGEGFFEKFGKSLIDG   178
MIT_Suva_c529_15556   
   --------------------------------------------------   
WashU_Sbay_Contig566.3   123   LGKNNKVNHLLGQYSASIAGPVYYNGNGHDSSNVGGGGFFEKFGKSLIDG   172
WashU_Scas_Contig688.28   136   NGSHLKRLNLLGHYSATIADPMTSSAS----SNPMGGSFFEKFGKSLIEG   181
WashU_Sklu_Contig2097.2   113   ------RLNLLGHYSASITGGHPVTNQ----QQLQQGGFFEIFGRTLVEG   152
Symbols










SGD_Scer_PUF3/YLL013C   183   TRELESQDRPDAVNTQSQFISKSVSNASLDTQNTFEQNVES--DKNFNKL   230
MIT_Smik_c1210_14353   177   TRELESQDRPEVTANQSQFIPESVSNASLDTQSTFEQTVQSDANSNN--L   224
MIT_Spar_c52_14884   179   TRELETQDRPEAAANQSQFIPKNVSNASLDTQSTFDQTAQS--DTNFNKL   226
MIT_Suva_c529_15556   
   --------------------------------------------------   
WashU_Sbay_Contig566.3   173   TRELESQDRPEHAANQPQFITKTVSNASLDTQTTFEQSVRSESNTNTNKM   222
WashU_Scas_Contig688.28   182   TRELESQTYLENNNNN------MSSTASVITQTTMPMNNNTDTETGSISE   225
WashU_Sklu_Contig2097.2   153   TREVELNLGTTSGRAS------RRESVNAMDSLARATTN----ATIQGSE   192
Symbols










SGD_Scer_PUF3/YLL013C   231   NRNTTNSGSLYHSSSNSGSSASLESE-NAHYPKRNIWNVANTPVFRPSNN   279
MIT_Smik_c1210_14353   225   NRNTTNSGSLYHSSSNSGSSASLESE-NAHYPKRNIWNVANTPVFRPSNS   273
MIT_Spar_c52_14884   227   NRNTTNSGSLYHSSSNSGSSASLESE-NAHYPKRNIWNVANTPVFRPGNN   275
MIT_Suva_c529_15556   
   --------------------------------------------------   
WashU_Sbay_Contig566.3   223   NTNTTNSGSFYHSSSNSDSSASLESDQNAHYPQRNIWNVANTPVFRPSNN   272
WashU_Scas_Contig688.28   226   SVETTENNIWNAATAPIFRPNPENEQPPGAFYPPHGFHPALFPNSGHYPP   275
WashU_Sklu_Contig2097.2   193   VSVPRERRVSISSDALESVSENLNMQDNKNAARRNIWNVANAPVFKPQGA   242
Symbols










SGD_Scer_PUF3/YLL013C   280   PAAVGATNVALPNQQDGPANNNFPPYMNGFPPNQFHQGPHYQNFPNYLIG   329
MIT_Smik_c1210_14353   274   PAGVGASNVLVPNQQDGLANNNFPSYINGFPPNQFHQGPQYQNFPNYLIG   323
MIT_Spar_c52_14884   276   PALVGAPNVVLPNQQDGPANNNFPPYMNGFPPNQFHQGPHYQNFSNYLIG   325
MIT_Suva_c529_15556   
   --------------------------------------------------   
WashU_Sbay_Contig566.3   273   PAVPGAPNMVAPNQQDGLANNNFPSYFP---PNQFHQGPHYQNFPNYLIG   319
WashU_Scas_Contig688.28   276   YPPYQNFQQHHNNNNNFPVGSPTAFISQMISPHSQPFIPGGKASNSDHNT   325
WashU_Sklu_Contig2097.2   243   DEEQPQNPEIFNSMYTFPYGPFQQFGGPLFAPMMSPPVPSPHPTIHTPAV   292
Symbols










SGD_Scer_PUF3/YLL013C   330   SPSNFISQMISVQIPANEDTEDSNGKKKKKANRPSSVSSPSSPPNNSPFP   379
MIT_Smik_c1210_14353   324   SPSNFISQMISVQIPTNEDTENAGGKKKKKANRPSSVSSPSSPPNNTPFS   373
MIT_Spar_c52_14884   326   SPSNFISQMISVQVPANEDTEDSNGKKKKKANRPSSVSSPSSPPNNTPFP   375
MIT_Suva_c529_15556   
   --------------------------------------------------   
WashU_Sbay_Contig566.3   320   SPSNFISQMISVQVPANEDTGDFDGKKKKKSNRPSSSSTPSSPPNTTPFP   369
WashU_Scas_Contig688.28   326   EYTIDNSQMAPYPPPNPIMFMPPPPPQGQQGFNSNKHSNPYLDNMDKPTK   375
WashU_Sklu_Contig2097.2   293   QDGGELDDTDDIGKNDAQRQHQQQQQQMPPQFVFPGNPYVFFPSGATPPP   342
Symbols










SGD_Scer_PUF3/YLL013C   380   FAYPNPMMFMPPPPLSAPQQQQQQQQQQ-------------QQEDQQQQQ   416
MIT_Smik_c1210_14353   374   FPYPNPMMFMPPPTPSATQQQHQQQQQQ------------------DQPQ   405
MIT_Spar_c52_14884   376   FAYPNPMMFIPPPPPSAPQQQQQQQQQQQQQQQQQQQQQQQQQQQQDQQQ   425
MIT_Suva_c529_15556   
   --------------------------------------------------   
WashU_Sbay_Contig566.3   370   YAYPNQMMFMPPPPPPSAPQQQQQQQ--------------------DQQE   399
WashU_Scas_Contig688.28   376   QQKNNSPSNNNNNNNNNNNNNNSKNSYRRHSP-----------AAHFDQI   414
WashU_Sklu_Contig2097.2   343   HPVPAPPQSASPVSTIESQQNTSNNSNGSHAN-----------VRTHGNP   381
Symbols










SGD_Scer_PUF3/YLL013C   417   QQENPYIYYPTPNPIPVKMPK-DEKTFKKRNNKNHPANNSNN---ANKQA   462
MIT_Smik_c1210_14353   406   QQENPYIYYPSPTHIPVKVHTKEEKNFKKRNNKNHPANNTNN---TNKQA   452
MIT_Spar_c52_14884   426   QQENPYIYYPSPNPVPVKVAK-DEKNFKKRNNKNHSANNANN---SNKQA   471
MIT_Suva_c529_15556   
   --------------------------------------------------   
WashU_Sbay_Contig566.3   400   HQENPYIYYPSPAPVPSNVPTKDEKNFKKRNNKNHPTNSANNNGNTNKQA   449
WashU_Scas_Contig688.28   415   HEHVNNNNNNKNVNPKHKMKGNKNNNMSAPSSSASTSSQQPSAPSSSSFH   464
WashU_Sklu_Contig2097.2   382   YLHHPRGSRLNNTGPPQFKP-------STPQQQAAPSQQNNKPKGKNNVP   424
Symbols










SGD_Scer_PUF3/YLL013C   463   NPYLENSIPTKNTSKKNASSKSNESTANNHKSHSHSHPHSQSLQ----QQ   508
MIT_Smik_c1210_14353   453   NPYLENLSTPKSSSKKNASSKSSESTGNSHKSQSQSQSQSQPQSSPHQQQ   502
MIT_Spar_c52_14884   472   NPYLESFAASKNSSKKNTSSKSNEPG--------TNNHKSHSQSPPQQQQ   513
MIT_Suva_c529_15556   
   --------------------------------------------------   
WashU_Sbay_Contig566.3   450   NPYLEILLPPKTRPKKTRLSSLMSQX------------------------   475
WashU_Scas_Contig688.28   465   RSPLLEELRNNPDNKKFTLKDIFGNTLEFCKDQYGSRFIQHELSTTSSPS   514
WashU_Sklu_Contig2097.2   425   RSALLEEFRNNPTNKTYRLSDIYGSALEFCKDQHGSRFIQQELVNAS-DA   473
Symbols










SGD_Scer_PUF3/YLL013C   509   QQTYHRSPLLEQLRNSSSDKNSNSNMSLKDIFGHSLEFCKDQHGSRFIQR   558
MIT_Smik_c1210_14353   503   QQMYHRSPLLEQLRSSGSDKNSNSSMSLKDIFGHSLEFCKDQHGSRFIQR   552
MIT_Spar_c52_14884   514   QQTYHRSPLLEQLRNSGSDKNSNSNMSLKDIFGHSLEFCKDQHGSRFIQR   563
MIT_Suva_c529_15556   
   --------------------------------------------------   
WashU_Sbay_Contig566.3   
   --------------------------------------------------   
WashU_Scas_Contig688.28   515   EREVIFN-------------------------------------------   521
WashU_Sklu_Contig2097.2   474   EKEVIFN-------------------------------------------   480
Symbols










SGD_Scer_PUF3/YLL013C   559   ELATSPASEKEVIFNEIRDDAIELSNDVFGNYVIQKFFEFGSKIQKNTLV   608
MIT_Smik_c1210_14353   553   ELATSPASEKEVIFNEIRDDAIELSNDVFGNYVIQKFFEFGSKIQKDALV   602
MIT_Spar_c52_14884   564   ELATSPASEKEVIFNEIRNDAIELSNDVFGNYVIQKFFEFGSKIQKDTLV   613
MIT_Suva_c529_15556   
   --------------------------------------------------   
WashU_Sbay_Contig566.3   
   --------------------------------------------------   
WashU_Scas_Contig688.28   522   ---------------ELRDEAISLSNDVFGNYVIQKFFEFGSVTQRDILV   556
WashU_Sklu_Contig2097.2   481   ---------------EIRDEAIALADDVFGNYVIQKFFEHGTKTQKDVLV   515
Symbols










SGD_Scer_PUF3/YLL013C   609   DQFKGNMKQLSLQMYACRVIQKALEYIDSNQRIELVLELSDSVLQMIKDQ   658
MIT_Smik_c1210_14353   603   EQFKGHMKQLSLQMYACRVIQKALEFIDSKQRIELVLELSDSVLQMIKDQ   652
MIT_Spar_c52_14884   614   EQFKGNMKQLSLQMYACRVIQKALEFIDSNQRIELVLELSDSVLQMIKDQ   663
MIT_Suva_c529_15556   1   ------MKQLSLQMYACRVIQKALEFIDSQQRIQLVVELSDSVLQMIKDQ   44
WashU_Sbay_Contig566.3   
   --------------------------------------------------   
WashU_Scas_Contig688.28   557   DQFKGKMQNLSLQMYACRVIQKALEFIKPDQRLELVSELSQCVLQMIKDQ   606
WashU_Sklu_Contig2097.2   516   EQFTGKMEQLSLEMYACRVIQRAFECIEEQQKVALVQELSHCVLHMIKDQ   565
Symbols










SGD_Scer_PUF3/YLL013C   659   NGNHVIQKAIETIPIEKLPFILSSLTGHIYHLSTHSYGCRVIQRLLEFGS   708
MIT_Smik_c1210_14353   653   NGNHVIQKAIETIPIEKLPFILSSLTGHIYHLSTHSYGCRVIQRLLEFGS   702
MIT_Spar_c52_14884   664   NGNHVIQKAIETIPIEKLPFILSSLTGHIYHLSTHSYGCRVIQRLLEFGS   713
MIT_Suva_c529_15556   45   NGNHVIQKAIETIPLKKLPFVLNSLTGHIYHLSTHSYGCRVIQRLLEFGS   94
WashU_Sbay_Contig566.3   
   --------------------------------------------------   
WashU_Scas_Contig688.28   607   NGNHVIQKAIECIPMKDLPFILDSLHGHIYHLSTHSYGCRVIQRLLEFGS   656
WashU_Sklu_Contig2097.2   566   NGNHVIQKAIERIPIDKLPFILGSLNEQIYHLSTHSYGCRVIQRLLEYGS   615
Symbols










SGD_Scer_PUF3/YLL013C   709   SEDQESILNELKDFIPYLIQDQYGNYVIQYVLQQD---QFTNKEMVDIKQ   755
MIT_Smik_c1210_14353   703   SNDQCSILNELKDFIPYLIQDQYGNYVIQYILQQN---QFTNKEMVDVKQ   749
MIT_Spar_c52_14884   714   SEDQKNILNELKDFIPYLIQDQYGNYVIQYILQQD---QFTNKEMVDIKQ   760
MIT_Suva_c529_15556   95   SEDQCNILNELKDFIPYLIQDQYGNYVIQYILQQD---QFTNKEMVDVKQ   141
WashU_Sbay_Contig566.3   
   --------------------------------------------------   
WashU_Scas_Contig688.28   657   LEDQTLILSELKDFIPYLIQDQYGNYVIQHILEQQDNNPNVSQEMMNTKQ   706
WashU_Sklu_Contig2097.2   616   LKDQDQILDELDQFIPYLIQDQYGNYVIQHILQHG--GEHTNIHIGSTKQ   663
Symbols










SGD_Scer_PUF3/YLL013C   756   EIIETVANNVVEYSKHKFASNVVEKSILYGSKNQKDLIISKILPRDKNHA   805
MIT_Smik_c1210_14353   750   EIIETVANNVVEYSKHKFASNVVEKSILYGSKDQKDLIMSKILPKDKNHA   799
MIT_Spar_c52_14884   761   EIIETVANNVVEYSKHKFASNVVEKSILYGSKDQKNLIMSMILPRDKNHA   810
MIT_Suva_c529_15556   142   EIVETVADNVVEYSKHKFASNVVEKSILYGSKDQKKLIMSKILPRDKNHA   191
WashU_Sbay_Contig566.3   
   --------------------------------------------------   
WashU_Scas_Contig688.28   707   EIVNIVSQNVVEFSKHKFASNVVERAILYGNEKQRNLIIRQILPRDKAHA   756
WashU_Sklu_Contig2097.2   664   NIVDIVSKSVVEYSKHKFASNVVEKTMLFGSDSQKRQIMDRILPKSLDHA   713
Symbols










SGD_Scer_PUF3/YLL013C   806   LNLEDDSPMILMIKDQFANYVIQKLVNVSEGEGKKLIVIAIRAYLDKLNK   855
MIT_Smik_c1210_14353   800   LNLEDDSPMILMIKDQFANYVIQKLVNVSEGEGKKLIVIAIRAYLDKLNK   849
MIT_Spar_c52_14884   811   LNLEDGSPMILMIKDQFANYVIQKLVNVSEGEGKKLIVIAIRAYLDKLNK   860
MIT_Suva_c529_15556   192   LNLEDDSPMILMIKDQFANYVIQKLVNVSEGEGKKLIVVAIRAYLDKLNK   241
WashU_Sbay_Contig566.3   
   --------------------------------------------------   
WashU_Scas_Contig688.28   757   ENLEDNAPMILMMRDQFANYVVQKLVTVSEGEGKTLIVIAIRSYLDKLNK   806
WashU_Sklu_Contig2097.2   714   AHLEDNAPLILMMRDQYANYVVQKLVGVAQGEDKKLIVVAIRSYLDRLNK   763
Symbols










SGD_Scer_PUF3/YLL013C   856   SNSLGNRHLASVEKLAALVENAEV-   879
MIT_Smik_c1210_14353   850   SNSLGNRHLASVEKLAALVENAEV-   873
MIT_Spar_c52_14884   861   SNSLGNRHLASVEKLAALVENAEV-   884
MIT_Suva_c529_15556   242   SNSLGNRHLASVEKLAALVENAEV-   265
WashU_Sbay_Contig566.3   
   -------------------------   
WashU_Scas_Contig688.28   807   SNSLGNRHLASIEKLASLVETVKID   831
WashU_Sklu_Contig2097.2   764   VNALGNRHLASVEKLAALVEKVEI-   787
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_PUF3/YLL013C:

SGD_Scer_PUF3/YLL013C  Length: 880  Mon Nov  7 16:00:48 2016  Type: P  Check: 1670  ..

       1  MEMNMDMDMD MELASIVSSL SALSHSNNNG GQAAAAGIVN GGAAGSQQIG

      51  GFRRSSFTTA NEVDSEILLL HGSSESSPIF KKTALSVGTA PPFSTNSKKF

     101  FGNGGNYYQY RSTDTASLSS ASYNNYHTHH TAANLGKNNK VNHLLGQYSA

     151  SIAGPVYYNG NDNNNSGGEG FFEKFGKSLI DGTRELESQD RPDAVNTQSQ

     201  FISKSVSNAS LDTQNTFEQN VESDKNFNKL NRNTTNSGSL YHSSSNSGSS

     251  ASLESENAHY PKRNIWNVAN TPVFRPSNNP AAVGATNVAL PNQQDGPANN

     301  NFPPYMNGFP PNQFHQGPHY QNFPNYLIGS PSNFISQMIS VQIPANEDTE

     351  DSNGKKKKKA NRPSSVSSPS SPPNNSPFPF AYPNPMMFMP PPPLSAPQQQ

     401  QQQQQQQQQE DQQQQQQQEN PYIYYPTPNP IPVKMPKDEK TFKKRNNKNH

     451  PANNSNNANK QANPYLENSI PTKNTSKKNA SSKSNESTAN NHKSHSHSHP

     501  HSQSLQQQQQ TYHRSPLLEQ LRNSSSDKNS NSNMSLKDIF GHSLEFCKDQ

     551  HGSRFIQREL ATSPASEKEV IFNEIRDDAI ELSNDVFGNY VIQKFFEFGS

     601  KIQKNTLVDQ FKGNMKQLSL QMYACRVIQK ALEYIDSNQR IELVLELSDS

     651  VLQMIKDQNG NHVIQKAIET IPIEKLPFIL SSLTGHIYHL STHSYGCRVI

     701  QRLLEFGSSE DQESILNELK DFIPYLIQDQ YGNYVIQYVL QQDQFTNKEM

     751  VDIKQEIIET VANNVVEYSK HKFASNVVEK SILYGSKNQK DLIISKILPR

     801  DKNHALNLED DSPMILMIKD QFANYVIQKL VNVSEGEGKK LIVIAIRAYL

     851  DKLNKSNSLG NRHLASVEKL AALVENAEV*

Protein Sequence for MIT_Smik_c1210_14353:

MIT_Smik_c1210_14353  Length: 874  Mon Nov  7 16:00:48 2016  Type: P  Check: 7672  ..

       1  MDMDMDMELA SIVSSLSALS NGNNNGSQAT AIVGSATAGS QQIGGFRRSS

      51  FTTSNDIDSD ILLLHGSSES SPIFKKTALS VGTAPPFSTN SKKFFGNGSN

     101  YYHYRSNDTS SLSSASHNNY QTHNAAGNLG KNNKVNHLLG QYSASIAGPV

     151  YYNGNENNNS GGEGFFEKFG KSLIDGTREL ESQDRPEVTA NQSQFIPESV

     201  SNASLDTQST FEQTVQSDAN SNNLNRNTTN SGSLYHSSSN SGSSASLESE

     251  NAHYPKRNIW NVANTPVFRP SNSPAGVGAS NVLVPNQQDG LANNNFPSYI

     301  NGFPPNQFHQ GPQYQNFPNY LIGSPSNFIS QMISVQIPTN EDTENAGGKK

     351  KKKANRPSSV SSPSSPPNNT PFSFPYPNPM MFMPPPTPSA TQQQHQQQQQ

     401  QDQPQQQENP YIYYPSPTHI PVKVHTKEEK NFKKRNNKNH PANNTNNTNK

     451  QANPYLENLS TPKSSSKKNA SSKSSESTGN SHKSQSQSQS QSQPQSSPHQ

     501  QQQQMYHRSP LLEQLRSSGS DKNSNSSMSL KDIFGHSLEF CKDQHGSRFI

     551  QRELATSPAS EKEVIFNEIR DDAIELSNDV FGNYVIQKFF EFGSKIQKDA

     601  LVEQFKGHMK QLSLQMYACR VIQKALEFID SKQRIELVLE LSDSVLQMIK

     651  DQNGNHVIQK AIETIPIEKL PFILSSLTGH IYHLSTHSYG CRVIQRLLEF

     701  GSSNDQCSIL NELKDFIPYL IQDQYGNYVI QYILQQNQFT NKEMVDVKQE

     751  IIETVANNVV EYSKHKFASN VVEKSILYGS KDQKDLIMSK ILPKDKNHAL

     801  NLEDDSPMIL MIKDQFANYV IQKLVNVSEG EGKKLIVIAI RAYLDKLNKS

     851  NSLGNRHLAS VEKLAALVEN AEV*

Protein Sequence for MIT_Spar_c52_14884:

MIT_Spar_c52_14884  Length: 885  Mon Nov  7 16:00:48 2016  Type: P  Check: 1646  ..

       1  MEMDMDMDME LASIVSSLSA LSNGNNNGGQ AGAIVSGSAA GSQQIGGFRR

      51  SSFTTANEVD SEILLLHGSS ESSPIFKKTA LSVGTAPPFS TNSKKFFGNG

     101  GNYYQYRSND TASLSSTSYS NYHTHHAAGN LGKNNKVNHL LGQYSASIAG

     151  PVYYNGNDNS NSGGEGFFEK FGKSLIDGTR ELETQDRPEA AANQSQFIPK

     201  NVSNASLDTQ STFDQTAQSD TNFNKLNRNT TNSGSLYHSS SNSGSSASLE

     251  SENAHYPKRN IWNVANTPVF RPGNNPALVG APNVVLPNQQ DGPANNNFPP

     301  YMNGFPPNQF HQGPHYQNFS NYLIGSPSNF ISQMISVQVP ANEDTEDSNG

     351  KKKKKANRPS SVSSPSSPPN NTPFPFAYPN PMMFIPPPPP SAPQQQQQQQ

     401  QQQQQQQQQQ QQQQQQQQQQ QDQQQQQENP YIYYPSPNPV PVKVAKDEKN

     451  FKKRNNKNHS ANNANNSNKQ ANPYLESFAA SKNSSKKNTS SKSNEPGTNN

     501  HKSHSQSPPQ QQQQQTYHRS PLLEQLRNSG SDKNSNSNMS LKDIFGHSLE

     551  FCKDQHGSRF IQRELATSPA SEKEVIFNEI RNDAIELSND VFGNYVIQKF

     601  FEFGSKIQKD TLVEQFKGNM KQLSLQMYAC RVIQKALEFI DSNQRIELVL

     651  ELSDSVLQMI KDQNGNHVIQ KAIETIPIEK LPFILSSLTG HIYHLSTHSY

     701  GCRVIQRLLE FGSSEDQKNI LNELKDFIPY LIQDQYGNYV IQYILQQDQF

     751  TNKEMVDIKQ EIIETVANNV VEYSKHKFAS NVVEKSILYG SKDQKNLIMS

     801  MILPRDKNHA LNLEDGSPMI LMIKDQFANY VIQKLVNVSE GEGKKLIVIA

     851  IRAYLDKLNK SNSLGNRHLA SVEKLAALVE NAEV*

Protein Sequence for MIT_Suva_c529_15556:

MIT_Suva_c529_15556  Length: 266  Mon Nov  7 16:00:48 2016  Type: P  Check: 9633  ..

       1  MKQLSLQMYA CRVIQKALEF IDSQQRIQLV VELSDSVLQM IKDQNGNHVI

      51  QKAIETIPLK KLPFVLNSLT GHIYHLSTHS YGCRVIQRLL EFGSSEDQCN

     101  ILNELKDFIP YLIQDQYGNY VIQYILQQDQ FTNKEMVDVK QEIVETVADN

     151  VVEYSKHKFA SNVVEKSILY GSKDQKKLIM SKILPRDKNH ALNLEDDSPM

     201  ILMIKDQFAN YVIQKLVNVS EGEGKKLIVV AIRAYLDKLN KSNSLGNRHL

     251  ASVEKLAALV ENAEV*

Protein Sequence for WashU_Sbay_Contig566.3:

WashU_Sbay_Contig566.3  Length: 475  Mon Nov  7 16:00:48 2016  Type: P  Check: 8683  ..

       1  MELASIVSSL SALSNGNNNG GQAAAVVGGA AAGSQQIGGF RRSSFTTSND

      51  IDSDILLLHG SSESSPIFKK TALSVGTAPP FSTNSKKFFG NNSNYYQYRS

     101  NDTASLSSAS YNNYQTNNAA GNLGKNNKVN HLLGQYSASI AGPVYYNGNG

     151  HDSSNVGGGG FFEKFGKSLI DGTRELESQD RPEHAANQPQ FITKTVSNAS

     201  LDTQTTFEQS VRSESNTNTN KMNTNTTNSG SFYHSSSNSD SSASLESDQN

     251  AHYPQRNIWN VANTPVFRPS NNPAVPGAPN MVAPNQQDGL ANNNFPSYFP

     301  PNQFHQGPHY QNFPNYLIGS PSNFISQMIS VQVPANEDTG DFDGKKKKKS

     351  NRPSSSSTPS SPPNTTPFPY AYPNQMMFMP PPPPPSAPQQ QQQQQDQQEH

     401  QENPYIYYPS PAPVPSNVPT KDEKNFKKRN NKNHPTNSAN NNGNTNKQAN

     451  PYLEILLPPK TRPKKTRLSS LMSQX

Protein Sequence for WashU_Scas_Contig688.28:

WashU_Scas_Contig688.28  Length: 832  Mon Nov  7 16:00:48 2016  Type: P  Check: 8365  ..

       1  MTILNALDPW LDRNSHDNGS NTQPQHQSQM DAELASIVSS LSALSASNNI

      51  ANANSQAQQI GGFRRSSFNQ SDIDSEILLL NNNQNQTRNT LSVGAAPNYY

     101  NQQQANIYSP SSSDSSPPPQ FPAPFPHVSK SINDINGSHL KRLNLLGHYS

     151  ATIADPMTSS ASSNPMGGSF FEKFGKSLIE GTRELESQTY LENNNNNMSS

     201  TASVITQTTM PMNNNTDTET GSISESVETT ENNIWNAATA PIFRPNPENE

     251  QPPGAFYPPH GFHPALFPNS GHYPPYPPYQ NFQQHHNNNN NFPVGSPTAF

     301  ISQMISPHSQ PFIPGGKASN SDHNTEYTID NSQMAPYPPP NPIMFMPPPP

     351  PQGQQGFNSN KHSNPYLDNM DKPTKQQKNN SPSNNNNNNN NNNNNNNSKN

     401  SYRRHSPAAH FDQIHEHVNN NNNNKNVNPK HKMKGNKNNN MSAPSSSAST

     451  SSQQPSAPSS SSFHRSPLLE ELRNNPDNKK FTLKDIFGNT LEFCKDQYGS

     501  RFIQHELSTT SSPSEREVIF NELRDEAISL SNDVFGNYVI QKFFEFGSVT

     551  QRDILVDQFK GKMQNLSLQM YACRVIQKAL EFIKPDQRLE LVSELSQCVL

     601  QMIKDQNGNH VIQKAIECIP MKDLPFILDS LHGHIYHLST HSYGCRVIQR

     651  LLEFGSLEDQ TLILSELKDF IPYLIQDQYG NYVIQHILEQ QDNNPNVSQE

     701  MMNTKQEIVN IVSQNVVEFS KHKFASNVVE RAILYGNEKQ RNLIIRQILP

     751  RDKAHAENLE DNAPMILMMR DQFANYVVQK LVTVSEGEGK TLIVIAIRSY

     801  LDKLNKSNSL GNRHLASIEK LASLVETVKI D*

Protein Sequence for WashU_Sklu_Contig2097.2:

WashU_Sklu_Contig2097.2  Length: 788  Mon Nov  7 16:00:48 2016  Type: P  Check: 3698  ..

       1  MSTTGHPSAD PWSSFDYKST RPSKMDSELA SIVSSLSALS NPSAQHGQPH

      51  QLSQAQGHQG QLGGFRRPSI NSNNGSDVES EILFQNQTSP VLRRTTLSVG

     101  GASVGAPNGV NNRLNLLGHY SASITGGHPV TNQQQLQQGG FFEIFGRTLV

     151  EGTREVELNL GTTSGRASRR ESVNAMDSLA RATTNATIQG SEVSVPRERR

     201  VSISSDALES VSENLNMQDN KNAARRNIWN VANAPVFKPQ GADEEQPQNP

     251  EIFNSMYTFP YGPFQQFGGP LFAPMMSPPV PSPHPTIHTP AVQDGGELDD

     301  TDDIGKNDAQ RQHQQQQQQM PPQFVFPGNP YVFFPSGATP PPHPVPAPPQ

     351  SASPVSTIES QQNTSNNSNG SHANVRTHGN PYLHHPRGSR LNNTGPPQFK

     401  PSTPQQQAAP SQQNNKPKGK NNVPRSALLE EFRNNPTNKT YRLSDIYGSA

     451  LEFCKDQHGS RFIQQELVNA SDAEKEVIFN EIRDEAIALA DDVFGNYVIQ

     501  KFFEHGTKTQ KDVLVEQFTG KMEQLSLEMY ACRVIQRAFE CIEEQQKVAL

     551  VQELSHCVLH MIKDQNGNHV IQKAIERIPI DKLPFILGSL NEQIYHLSTH

     601  SYGCRVIQRL LEYGSLKDQD QILDELDQFI PYLIQDQYGN YVIQHILQHG

     651  GEHTNIHIGS TKQNIVDIVS KSVVEYSKHK FASNVVEKTM LFGSDSQKRQ

     701  IMDRILPKSL DHAAHLEDNA PLILMMRDQY ANYVVQKLVG VAQGEDKKLI

     751  VVAIRSYLDR LNKVNALGNR HLASVEKLAA LVEKVEI*