Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YKR029C and Homologs


Choose two or more sequences for alignment:
Pick a sequence type:
Best Hits & Orthologs"Other" Hits

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_SET3/YKR029C   1   ------MSVPNSKEQSLLDDASTLLLFSKGKKRAEEASKIGSKTDTIEHD   44
MIT_Smik_c117_13778   1   ------MSVPHSKDQSLLDDASTLLLFSKGKNRPEEASKKDSKADTIEHD   44
WashU_Sbay_Contig473.3   1   ------MSLPNSKEQSLLDDASTLLLFSKG-NKPEEALTADSKAGIAGSE   43
WashU_Scas_Contig603.11   1   MSPTESPTKQPSTERSLFDDASTLLMFSKS----QPQTQIPPVEDATNQQ   46
Symbols






: *.::**:*******:***. : . . :



SGD_Scer_SET3/YKR029C   45   ESHEREKKGAIEMAAAALATASTVSLPLKKATEQSAAEAATSTAAKEETE   94
MIT_Smik_c117_13778   45   ECHESEK-----MGAIAMTAAASVPLPPKKSTEQSMTAATVTTTTKEEHT   89
WashU_Sbay_Contig473.3   44   DDYEREKKGAVAMAAAALATAASVPLPLKRTAQQMIPKATTAIITEEKKE   93
WashU_Scas_Contig603.11   47   AIDPAASAAAVTLAAAANLTSPSTQSQYQEEEPKVEDIKFEATTTPTKRK   96
Symbols






. :.* * ::.:. :. : : : :



SGD_Scer_SET3/YKR029C   95   NQPQKQPQWPVPDSYIVDPDAGIITCICDLNDDDGFTIQCDHCNRWQHAI   144
MIT_Smik_c117_13778   90   E---KQPPWPVPDSYIVDPDAGIITCICDLNDDDGFTIQCDHCNRWQHAI   136
WashU_Sbay_Contig473.3   94   T--EKHAQWPVPDTYIVDPDAGIITCICDMNDDDGFTIQCDHCNRWQHAI   141
WashU_Scas_Contig603.11   97   GK-KKKKKWPVDDSYIVDPDAGIITCLCDFDDDDGFTIQCDHCNRWQHAV   145
Symbols






*: *** *:************:**::******************:



SGD_Scer_SET3/YKR029C   145   CYGIKDIGMAPDDYLCNSCDPRE-VDINLARKIQQERINVKTVEPSSSNN   193
MIT_Smik_c117_13778   137   CYGIKDIEMAPDDYLCNSCDPRT-VDIDLARQIQRERLGVKTVYPSMSSN   185
WashU_Sbay_Contig473.3   142   CYGIKDVEMAPDDYLCNSCDPRK-VDVELARRIQHSRLGVKTMTSATN-D   189
WashU_Scas_Contig603.11   146   CFGIKDIDSAPENHLCNVCQPRDDLNVEVARRRQLRQRSLLTVQNISPEN   195
Symbols






*:****: **:::*** *:** :::::**: * : .: *: :



SGD_Scer_SET3/YKR029C   194   SASNKNNGRDRASSTTISDVGDSFSTDQDNTNHRDKRRKRNPSNNSIDSK   243
MIT_Smik_c117_13778   186   GSSNKNNSRDRAPSISNSDGGESLSADRENSNHKDKRRKKTPSNNRAESK   235
WashU_Sbay_Contig473.3   190   INDNKNNSRERALSTTANDNGDVLSTDQESSGHKDKRRKRNSSNNSLDPK   239
WashU_Scas_Contig603.11   196   VADIGKRRKRRND-------KDEYNIERPQQKRQNSRHDNIEQDGPGKGQ   238
Symbols






. :. : * : . :: . :::.*:.. .:. . :



SGD_Scer_SET3/YKR029C   244   NESASVNSSDGLTSMPKKKEHFLSAKDAYGAIYLPLKDNVFKSDLIEPFL   293
MIT_Smik_c117_13778   236   NESASASSFETLVTTQKKKEHFLSAKDAYGAIYLPLKKYVFKDELMELFL   285
WashU_Sbay_Contig473.3   240   TESASATSSEPAASIQKKKEHFLSAKDAYGAIYLPLKKYVFKSELIQLFL   289
WashU_Scas_Contig603.11   239   QGGNEVPNIPTPDLVVRRKEHFLTAKEAYGASFLPIDTYRMKNETVALFL   288
Symbols






. .. . ::*****:**:**** :**:. :*.: : **



SGD_Scer_SET3/YKR029C   294   NKHMDDNWVIQYPHKTFKSVSIEVKPYADIAYSRTYPGFTKLGVYLKKDC   343
MIT_Smik_c117_13778   286   DKHKDDDCIIQYPHKTFKAMSIEVKPYADIAYSRTYPGFTKLGVYLKRDC   335
WashU_Sbay_Contig473.3   290   KMHMDDDWVMQYSHKTFKAIPIEVRPYADIAYSRTYPGFTKLGVYLKRDC   339
WashU_Scas_Contig603.11   289   DKHKNDAFITIIED--FAPLDIEVKPYADFNYSRTFPGFPKLGTFLPEGC   336
Symbols






. * :* : . * .: ***:****: ****:***.***.:* ..*



SGD_Scer_SET3/YKR029C   344   IKGDFIQEILGELDFYKNYLTDPRNHYRIWGTAKRRVIFHSHWPIYIDAR   393
MIT_Smik_c117_13778   336   VKGDFIQEILGDLDFRSNYLTDPRNQYRVWGTAKRRVIFHSHWPIYIDAR   385
WashU_Sbay_Contig473.3   340   MKGDFVQEFLGELDFRKNYLTDSRNHYRIWGTPKRRVIFHPHWPIYIDAR   389
WashU_Scas_Contig603.11   337   NESALIQEFLGELNFKEDYLDDPRNMYRIWGTVKSKVVFHPNWPLCIDAR   386
Symbols






:. ::**:**:*:* .:** *.** **:*** * :*:**.:**: ****



SGD_Scer_SET3/YKR029C   394   LSGNSTRYLRRSCQPNVELVTIKLQDTDNRNDKSSGRKSSRIKFVLRALR   443
MIT_Smik_c117_13778   386   LSGNSTRYLRRSCQPNVELVTIKLQDAENTNDKNN-----KIKFVLRALR   430
WashU_Sbay_Contig473.3   390   SSGNLTRYLRRSCQPNVELVTIRLQDLDHENVNSNGTNVSKIKFVLRALR   439
WashU_Scas_Contig603.11   387   SCGNLARYIRRCCNPNVGLSTVKIKETN------------EIKFVLKALR   424
Symbols






.** :**:**.*:*** * *::::: : .*****:***



SGD_Scer_SET3/YKR029C   444   DISEDEELYIKWQWDSKHPILKLIKG-MTIDSLDDLERYGLINSVETILS   492
MIT_Smik_c117_13778   431   GISENEELYIKWQWDSRHPILKLIGD-TTIDSLTDLEKYGLINSIETILS   479
WashU_Sbay_Contig473.3   440   DISEDEELYIKWQWDLKQPISKLIDDSATIESLTDLEKYGLINSVETILS   489
WashU_Scas_Contig603.11   425   DINPGEELHLSWHWDKKHPIRKLIEDDETFDTLSEEEKFLLINSVDSILS   474
Symbols






.*. .***::.*:** ::** *** . *:::* : *:: ****:::***



SGD_Scer_SET3/YKR029C   493   NGECGCGNN----SKDCYLLKVKRYAQSLYKSVKSRGKMNNRYKLNEILN   538
MIT_Smik_c117_13778   480   NGECGCGNN----SKDCYLLKVKRYSQSLYKSVKSRAKMSNRYKLNEILN   525
WashU_Sbay_Contig473.3   490   NGECGCGNN----SKDCYLLKVKRYSQSLYKSVKLRMKISNRYKLNEILN   535
WashU_Scas_Contig603.11   475   SCDCGCTNNGNLNNKDCHILKVKKAIQPLVKSVK--QKMNNRYKLNAVLD   522
Symbols






. :*** ** .***::****: *.* **** *:.****** :*:



SGD_Scer_SET3/YKR029C   539   QYNCKKRREPPILHRLEEKAQN--TIERAPILLNNFYRQKFLNRNNGPKI   586
MIT_Smik_c117_13778   526   QYEHKKRREPPILHRLEEKAVT--AIEKAPIILNTFHQRKFLDRTDGTKS   573
WashU_Sbay_Contig473.3   536   KYEDKKRREPPILNWLEEKAQT--AIERAPILLGKYHQQKFLNRNDGITV   583
WashU_Scas_Contig603.11   523   ELDHRRARPKPILERLLNQSFKNRSTNRQEIISKILNNMNPQDKGYHLLS   572
Symbols






: : :: * ***. * ::: . : :: *: . : ::



SGD_Scer_SET3/YKR029C   587   PQKNTIDSTNNP-------------DDIAKPFKFALFAQHSSNISVPKKN   623
MIT_Smik_c117_13778   574   SRKDSITGAYED-------------QGIVKPFKFNLFTQYSSNVPVPKNI   610
WashU_Sbay_Contig473.3   584   TQS-TIANADEV-------------CNIVKPFKINLLSRYSSTANTPEGI   619
WashU_Scas_Contig603.11   573   STYGSILPITDLSATNRRKSEGLVVANTHQPFKVSVLKNKSILRTDSRKG   622
Symbols






. :* : . :***. :: . * ..



SGD_Scer_SET3/YKR029C   624   ETSEKPLIITKSTDYDESHITNIEELPIPVLLPINKTSRQTANDVEESQS   673
MIT_Smik_c117_13778   611   EAREKPLIIKKSSDYDESHITNIKELPIPVPLPVSKTSWQTVTDFNNVQS   660
WashU_Sbay_Contig473.3   620   KTEGEYITIKKSSDYDESHITNIKELPIPIPLSVVKTPGQITSEVNNGQS   669
WashU_Scas_Contig603.11   623   AKNTKIKALKKPSYFDETMITDLDKLLTPIELIVPQSLQRGVTLESQSVG   672
Symbols






: :.*.: :**: **::.:* *: * : :: : .. .: .



SGD_Scer_SET3/YKR029C   674   KNEHKLSRTPSLSNFNKELSKEAQHSQAKTKEIMTEASVNSRRESTPESI   723
MIT_Smik_c117_13778   661   KN-EHIARTLSLPNSNKELLEEKEQNQNKTGEITTEALTNSKQELSPESI   709
WashU_Sbay_Contig473.3   670   KNEHTLTRTPSLSSFNKELSEEKE--HHIVMEPMTDTSTSSRHELSPESM   717
WashU_Scas_Contig603.11   673   LGLNQSHNPEEIEKLNKIQDVDLLSGMKPSENVIEDTKYDISRVSSSPKI   722
Symbols






. . .. .: . ** : : :: . : :. .:



SGD_Scer_SET3/YKR029C   724   MHLSDFSSS--------------------QLHSKKKLSFADYRKKLLK   751
MIT_Smik_c117_13778   710   MHLSDFSSS--------------------QLHSKKKLSFADYKKKLLK   737
WashU_Sbay_Contig473.3   718   RHLADFSSS--------------------QLHSKKKLSFADYRKKLLK   745
WashU_Scas_Contig603.11   723   LASSRPSSAGGINTSENTEYKEAVSNTVPTAHLKKKLSFADYRKKLQK   770
Symbols






: **: * *********:*** *



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_SET3/YKR029C:

SGD_Scer_SET3/YKR029C  Length: 752  Mon Nov  7 15:58:44 2016  Type: P  Check: 6447  ..

       1  MSVPNSKEQS LLDDASTLLL FSKGKKRAEE ASKIGSKTDT IEHDESHERE

      51  KKGAIEMAAA ALATASTVSL PLKKATEQSA AEAATSTAAK EETENQPQKQ

     101  PQWPVPDSYI VDPDAGIITC ICDLNDDDGF TIQCDHCNRW QHAICYGIKD

     151  IGMAPDDYLC NSCDPREVDI NLARKIQQER INVKTVEPSS SNNSASNKNN

     201  GRDRASSTTI SDVGDSFSTD QDNTNHRDKR RKRNPSNNSI DSKNESASVN

     251  SSDGLTSMPK KKEHFLSAKD AYGAIYLPLK DNVFKSDLIE PFLNKHMDDN

     301  WVIQYPHKTF KSVSIEVKPY ADIAYSRTYP GFTKLGVYLK KDCIKGDFIQ

     351  EILGELDFYK NYLTDPRNHY RIWGTAKRRV IFHSHWPIYI DARLSGNSTR

     401  YLRRSCQPNV ELVTIKLQDT DNRNDKSSGR KSSRIKFVLR ALRDISEDEE

     451  LYIKWQWDSK HPILKLIKGM TIDSLDDLER YGLINSVETI LSNGECGCGN

     501  NSKDCYLLKV KRYAQSLYKS VKSRGKMNNR YKLNEILNQY NCKKRREPPI

     551  LHRLEEKAQN TIERAPILLN NFYRQKFLNR NNGPKIPQKN TIDSTNNPDD

     601  IAKPFKFALF AQHSSNISVP KKNETSEKPL IITKSTDYDE SHITNIEELP

     651  IPVLLPINKT SRQTANDVEE SQSKNEHKLS RTPSLSNFNK ELSKEAQHSQ

     701  AKTKEIMTEA SVNSRRESTP ESIMHLSDFS SSQLHSKKKL SFADYRKKLL

     751  K*

Protein Sequence for MIT_Smik_c117_13778:

MIT_Smik_c117_13778  Length: 738  Mon Nov  7 15:58:44 2016  Type: P  Check: 3025  ..

       1  MSVPHSKDQS LLDDASTLLL FSKGKNRPEE ASKKDSKADT IEHDECHESE

      51  KMGAIAMTAA ASVPLPPKKS TEQSMTAATV TTTTKEEHTE KQPPWPVPDS

     101  YIVDPDAGII TCICDLNDDD GFTIQCDHCN RWQHAICYGI KDIEMAPDDY

     151  LCNSCDPRTV DIDLARQIQR ERLGVKTVYP SMSSNGSSNK NNSRDRAPSI

     201  SNSDGGESLS ADRENSNHKD KRRKKTPSNN RAESKNESAS ASSFETLVTT

     251  QKKKEHFLSA KDAYGAIYLP LKKYVFKDEL MELFLDKHKD DDCIIQYPHK

     301  TFKAMSIEVK PYADIAYSRT YPGFTKLGVY LKRDCVKGDF IQEILGDLDF

     351  RSNYLTDPRN QYRVWGTAKR RVIFHSHWPI YIDARLSGNS TRYLRRSCQP

     401  NVELVTIKLQ DAENTNDKNN KIKFVLRALR GISENEELYI KWQWDSRHPI

     451  LKLIGDTTID SLTDLEKYGL INSIETILSN GECGCGNNSK DCYLLKVKRY

     501  SQSLYKSVKS RAKMSNRYKL NEILNQYEHK KRREPPILHR LEEKAVTAIE

     551  KAPIILNTFH QRKFLDRTDG TKSSRKDSIT GAYEDQGIVK PFKFNLFTQY

     601  SSNVPVPKNI EAREKPLIIK KSSDYDESHI TNIKELPIPV PLPVSKTSWQ

     651  TVTDFNNVQS KNEHIARTLS LPNSNKELLE EKEQNQNKTG EITTEALTNS

     701  KQELSPESIM HLSDFSSSQL HSKKKLSFAD YKKKLLK*

Protein Sequence for WashU_Sbay_Contig473.3:

WashU_Sbay_Contig473.3  Length: 746  Mon Nov  7 15:58:44 2016  Type: P  Check: 2372  ..

       1  MSLPNSKEQS LLDDASTLLL FSKGNKPEEA LTADSKAGIA GSEDDYEREK

      51  KGAVAMAAAA LATAASVPLP LKRTAQQMIP KATTAIITEE KKETEKHAQW

     101  PVPDTYIVDP DAGIITCICD MNDDDGFTIQ CDHCNRWQHA ICYGIKDVEM

     151  APDDYLCNSC DPRKVDVELA RRIQHSRLGV KTMTSATNDI NDNKNNSRER

     201  ALSTTANDNG DVLSTDQESS GHKDKRRKRN SSNNSLDPKT ESASATSSEP

     251  AASIQKKKEH FLSAKDAYGA IYLPLKKYVF KSELIQLFLK MHMDDDWVMQ

     301  YSHKTFKAIP IEVRPYADIA YSRTYPGFTK LGVYLKRDCM KGDFVQEFLG

     351  ELDFRKNYLT DSRNHYRIWG TPKRRVIFHP HWPIYIDARS SGNLTRYLRR

     401  SCQPNVELVT IRLQDLDHEN VNSNGTNVSK IKFVLRALRD ISEDEELYIK

     451  WQWDLKQPIS KLIDDSATIE SLTDLEKYGL INSVETILSN GECGCGNNSK

     501  DCYLLKVKRY SQSLYKSVKL RMKISNRYKL NEILNKYEDK KRREPPILNW

     551  LEEKAQTAIE RAPILLGKYH QQKFLNRNDG ITVTQSTIAN ADEVCNIVKP

     601  FKINLLSRYS STANTPEGIK TEGEYITIKK SSDYDESHIT NIKELPIPIP

     651  LSVVKTPGQI TSEVNNGQSK NEHTLTRTPS LSSFNKELSE EKEHHIVMEP

     701  MTDTSTSSRH ELSPESMRHL ADFSSSQLHS KKKLSFADYR KKLLK*


Protein Sequence for WashU_Scas_Contig603.11:

WashU_Scas_Contig603.11  Length: 771  Mon Nov  7 15:58:44 2016  Type: P  Check: 3574  ..

       1  MSPTESPTKQ PSTERSLFDD ASTLLMFSKS QPQTQIPPVE DATNQQAIDP

      51  AASAAAVTLA AAANLTSPST QSQYQEEEPK VEDIKFEATT TPTKRKGKKK

     101  KKKWPVDDSY IVDPDAGIIT CLCDFDDDDG FTIQCDHCNR WQHAVCFGIK

     151  DIDSAPENHL CNVCQPRDDL NVEVARRRQL RQRSLLTVQN ISPENVADIG

     201  KRRKRRNDKD EYNIERPQQK RQNSRHDNIE QDGPGKGQQG GNEVPNIPTP

     251  DLVVRRKEHF LTAKEAYGAS FLPIDTYRMK NETVALFLDK HKNDAFITII

     301  EDFAPLDIEV KPYADFNYSR TFPGFPKLGT FLPEGCNESA LIQEFLGELN

     351  FKEDYLDDPR NMYRIWGTVK SKVVFHPNWP LCIDARSCGN LARYIRRCCN

     401  PNVGLSTVKI KETNEIKFVL KALRDINPGE ELHLSWHWDK KHPIRKLIED

     451  DETFDTLSEE EKFLLINSVD SILSSCDCGC TNNGNLNNKD CHILKVKKAI

     501  QPLVKSVKQK MNNRYKLNAV LDELDHRRAR PKPILERLLN QSFKNRSTNR

     551  QEIISKILNN MNPQDKGYHL LSSTYGSILP ITDLSATNRR KSEGLVVANT

     601  HQPFKVSVLK NKSILRTDSR KGAKNTKIKA LKKPSYFDET MITDLDKLLT

     651  PIELIVPQSL QRGVTLESQS VGLGLNQSHN PEEIEKLNKI QDVDLLSGMK

     701  PSENVIEDTK YDISRVSSSP KILASSRPSS AGGINTSENT EYKEAVSNTV

     751  PTAHLKKKLS FADYRKKLQK *