Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YKL036C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_YKL036C   1   MCFGVLLSGHYYVMVHLLWKLYYIIGRGLGLLTLLMWKEPEIESPTPKTV   50
MIT_Smik_c109_13530   1   ---------------------------------MLIGKRAEIELSIRKTI   17
MIT_Spar_c324_13623   1   ----------------------------------------------MKNY   4
Symbols






*.



SGD_Scer_YKL036C   51   TSISWYLLEELCCLFRFIYSIQNRERKCKNGPSPNKRGSASGCSRRGGGR   100
MIT_Smik_c109_13530   18   TFILWYLLEEPCCLFRFIYSVQNREGKNKNGPSPDKE-------------   54
MIT_Spar_c324_13623   5   NFYLLYLLEELCCLFRFIYSIQNRERESKNGPSPNKEEARQAVREGAGGK   54
Symbols






. ***** *********:**** : ******:*.



SGD_Scer_YKL036C   101   GSGYKTLYRDLCENKPTPELWTLQAPELNL   130
MIT_Smik_c109_13530   
   ------------------------------   
MIT_Spar_c324_13623   55   GIRLQDDCTGICVAINRHRNLGLRKRQN--   82
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_YKL036C:

SGD_Scer_YKL036C  Length: 131  Mon Nov  7 15:53:48 2016  Type: P  Check: 8173  ..

       1  MCFGVLLSGH YYVMVHLLWK LYYIIGRGLG LLTLLMWKEP EIESPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERKCKN GPSPNKRGSA SGCSRRGGGR

     101  GSGYKTLYRD LCENKPTPEL WTLQAPELNL *

Protein Sequence for MIT_Smik_c109_13530:

MIT_Smik_c109_13530  Length: 55  Mon Nov  7 15:53:48 2016  Type: P  Check: 5428  ..

       1  MLIGKRAEIE LSIRKTITFI LWYLLEEPCC LFRFIYSVQN REGKNKNGPS

      51  PDKE*

Protein Sequence for MIT_Spar_c324_13623:

MIT_Spar_c324_13623  Length: 83  Mon Nov  7 15:53:48 2016  Type: P  Check: 291  ..

       1  MKNYNFYLLY LLEELCCLFR FIYSIQNRER ESKNGPSPNK EEARQAVREG

      51  AGGKGIRLQD DCTGICVAIN RHRNLGLRKR QN*