Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YJR136C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_TTI2/YJR136C   1   ----------------------MTAVTDIIDELNDSSLSSTRLRELCLQL   28
MIT_Smik_c740_12700   1   ----------------------MTPIDDIISELNELKISSARLSELCLQL   28
MIT_Spar_c310_12806   1   ----------------------MTVISDIIDELNDSCFTPTRLPDLCFKL   28
MIT_Suva_c603_13760   1   ----------------------MTTISDITDELNDPGLSFTRLSELCTQL   28
WashU_Sbay_Contig558.5   1   ----------------------MTTISDITDELNDPGLSFTRLSELCTQL   28
WashU_Scas_Contig719.77   1   --------------------MNREPWQTFVDRCLNGKDIPTVTSDELQQL   30
WashU_Sklu_Contig2443.5   1   ---------------MMTERVELSRLLTEIDSQIDDLPHEAQVEDLCRAL   35
WashU_Skud_Contig1942.6   1   MKTMKEMKTRRRAKNQKGTKKRMAKISDIIDELVDTKLSPARLSELCFQL   50
WashU_Smik_Contig2828.6   1   ----------------------MTPIDDIISELNELKISSARLSELCLQL   28
Symbols






. : : : *



SGD_Scer_TTI2/YJR136C   29   RKKTDTGCAITVSDEVNLIESLSYHSISPGVDIQINTDVLQTIDYYFQRN   78
MIT_Smik_c740_12700   29   REKVDTTCAITVADEIKLIESLSYHSISSRLDIQINNDVLKTIDRYFQLS   78
MIT_Spar_c310_12806   29   REKANGACAITVADEIKLIESLSYRSISPGLDIQINKDVLETIDQYFQRS   78
MIT_Suva_c603_13760   29   QDGIDSRCGLTVKDEIKIIESLSYHSIHEGVDLQINKHVLKTIDCYFRRN   78
WashU_Sbay_Contig558.5   29   QDGIDSRCGLTVKDEIKIIESLSYHSIHEGVDLQINKHVLKTIDCYFRRN   78
WashU_Scas_Contig719.77   31   KKIS---LSADVVDSQELILALSYAIMSD-------PDEIIPLILQLTSP   70
WashU_Sklu_Contig2443.5   36   TQNKEIISQESLARCLQYLSYFTINSLPWTTNEHLCHKCFSVISDFMT--   83
WashU_Skud_Contig1942.6   51   RENVDDVYATTMADEIKLIESLSYLSLSPGTEIQINNDVIKTIDKRFQSG   100
WashU_Smik_Contig2828.6   29   REKVDTTCAITVADEIKLIESLSYHSISSRLDIQINNDVLKTIDRYFQLS   78
Symbols






. : : : :: : . : : :



SGD_Scer_TTI2/YJR136C   79   KSEHDEIMCVLISKLQPLLLKRKSNFELKEQRN-----LGLKPTLGMSLK   123
MIT_Smik_c740_12700   79   EGNYDGIMWGLISALQPLLLKGKSNSGLKEQRN-----PGLKPTLGLSMK   123
MIT_Spar_c310_12806   79   KSRHDEIMGALISTLQPLLLKGKSHSELKEQHN-----LGLKPTLGMSLK   123
MIT_Suva_c603_13760   79   AHDHDGIMQALISSLQPLLLKGKSNSERKQQQN-----LGLKPVLGMSLK   123
WashU_Sbay_Contig558.5   79   AHDHDGIMQALISSLQPLLLKGKSNSERKQQQN-----LGLKPVLGMSLK   123
WashU_Scas_Contig719.77   71   AFTKKMAVDCLIEQLQPLLLKVSNRKLKREPMR--------LNNNNVDFR   112
WashU_Sklu_Contig2443.5   84   ----DDLLQVLIDRLRPMLLAIKNQKSSNSGRSRYTMGTGLKPKLGFGGE   129
WashU_Skud_Contig1942.6   101   RNHYGDIVRGLISSLQPLLLKGKSNSELKGQQN-----LVLKPALGMSLK   145
WashU_Smik_Contig2828.6   79   EGNYDGIMWGLISALQPLLLKGKSNSGLKEQRN-----PGLKPTLGLSMK   123
Symbols






: **. *:*:** ... . ... .



SGD_Scer_TTI2/YJR136C   124   EDNLMQAWVSQGGLKGIPLFYVILLHLKRRDISTNLSWIIPGILNILDDT   173
MIT_Smik_c740_12700   124   EDNITKAWVNQGGLKSIPLFYVILLYLKRKDVSTNLSWIIPGIINILDDT   173
MIT_Spar_c310_12806   124   EDNFIQTWVSQGGLKSIPLFYVILLHLKRKDISTNLSWIIPGILNILDDT   173
MIT_Suva_c603_13760   124   EDQLKEVWIRQDGLKSIPLFYVILLHIKRKDVSTNLSWIIPGILNILDDT   173
WashU_Sbay_Contig558.5   124   EDQLKEVWIRQDGLKSIPLFYVILLHIKRKDVSTNLSWIIPGILNILDDT   173
WashU_Scas_Contig719.77   113   QDEQRTQWKQNGGMKSIPLIFTIIRLLDRSDISSNLGWLTPAMLNLLDDT   162
WashU_Sklu_Contig2443.5   130   EDRIRDEWKRGGGLKSIPLFYVILSHLKSQNISSNLWWITPGILNLLDDT   179
WashU_Skud_Contig1942.6   146   EDNLREVWIGQGGLKSIPLFYVVLLHLKRKDVSTNLSWIVPGILNILDDT   195
WashU_Smik_Contig2828.6   124   EDNITKAWVNQGGLKSIPLFYVILLYLKRKDVSTNLSWIIPGIINILDNT   173
Symbols






:*. * .*:*.***::.:: :. ::*:** *: *.::*:**:*



SGD_Scer_TTI2/YJR136C   174   TDIRRIKLRGVLLLQTLLNHTFMNETNDSK---WIQFSSTGLFPLFEKTL   220
MIT_Smik_c740_12700   174   TDIRKIKLRGVLLLKTLLDYTFMSEPDNPK---WIQFSSTGLFPLFEKTL   220
MIT_Spar_c310_12806   174   TDIRKIKLRGVLLLQTLLNHTFMNEINDSK---WIQFSNTGLFPLFEKTL   220
MIT_Suva_c603_13760   174   TDLRKVKLRGVFLLQTALDHTFMHEINDSK---WIQFSSTGLFPLFEKAL   220
WashU_Sbay_Contig558.5   174   TDLRKVKLRGVFLLQTALDHTFMHEINDSK---WIQFSSTGLFPLFEKAL   220
WashU_Scas_Contig719.77   163   SDLTGIKLKSVILLDEFLNKFNNDNVDDTDDDKWISFKDTGLFALYEPIL   212
WashU_Sklu_Contig2443.5   180   SDIVGVKLQGVALLKQFLETTID--LKDTS---HFDFSQTGLFDAYQSIL   224
WashU_Skud_Contig1942.6   196   TDLRRIKLRGVLLLQTLLDHTFVCEIDDSK---WIQFSSIGLFPLLEKIL   242
WashU_Smik_Contig2828.6   174   TDIRKIKLRGVLLLKTLLDYTFMSEPDNPK---WIQFSSTGLFPLVEKTL   220
Symbols






:*: :**:.* **. *: .:.. :.*.. *** : *



SGD_Scer_TTI2/YJR136C   221   INMCYFLPPSYNADETIAIWRVVFPTIQSLYKVEFLDNYTKYQYHLEKFM   270
MIT_Smik_c740_12700   221   INMCYFLPPSYSADETVAIWRIVFPTILALYKVEFFADYTKYQYHLEKFM   270
MIT_Spar_c310_12806   221   INMCYFLPPSYNADETIAIWRIVFPTIHSLYRVEFFDDYTRYQYHLEKFM   270
MIT_Suva_c603_13760   221   INMCYFLPPSYDANETLAIWRLVFPTINSLYKVEFFDNKHKYQYHLEKFM   270
WashU_Sbay_Contig558.5   221   INMCYFLPPSYDANETLAIWRLVFPTINSLYKVEFFDNKHKYQYHLEKFM   270
WashU_Scas_Contig719.77   213   KLLCYYIPPMYTEKESLSTMQIAYPTLIKLYSTQFKKDTRMYKRKISEIL   262
WashU_Sklu_Contig2443.5   225   NSMCYYLPPSVDPKTTLTVWRAVYPTMLSLYRVQFYNEENIYCKHVKRFF   274
WashU_Skud_Contig1942.6   243   VNMCYFLPPSYNANDTLAIWRVVFPTIHSLYRVEFVNDNTKYQYHLEKFM   292
WashU_Smik_Contig2828.6   221   INMCYFLPPSYSADETVAIWRIVFPTILALYKVEFFADYTKYQYHLEKFM   270
Symbols






:**::** . ::: : .:**: ** .:* : * ::..::



SGD_Scer_TTI2/YJR136C   271   SEIILQNIIPRASLAYENLTLYALECTMNILRLQREGSVVHLQRLIFVLG   320
MIT_Smik_c740_12700   271   SGILLQNIIPRVSLAHENLTLYALETVSNMLKLQKEGSVVHLQRLIFVLG   320
MIT_Spar_c310_12806   271   SEILLQSIIPRASVTYENLTLYALETATNILKLQKEGSVVHLQRLIFVLG   320
MIT_Suva_c603_13760   271   SEILLQNIIPRASLNYENLTLYALETTATVLKLQKEGSVVHLQRLIYVLG   320
WashU_Sbay_Contig558.5   271   SEILLQNIIPRASLNYENLTLYALETTATVLKLQKEGSVVHLQRLIYVLG   320
WashU_Scas_Contig719.77   263   TELLLQNVIPRLDLKYDTLIIFSLQIMKQLITILQGQSIIHLQRIIYCLG   312
WashU_Sklu_Contig2443.5   275   SETILQIAIPRVSTDHVELTSFLLDLTIEILNLLKEQSVSHMQRILYTLG   324
WashU_Skud_Contig1942.6   293   SEILLQNIIPRASLTYDNLTTYALETATNILKLQKGGSVVHLQRLVYVLG   342
WashU_Smik_Contig2828.6   271   SGILLQNIIPRVSLAHENLTLYALGTVSNMLKLQKEGSVVHLQRLIFVLG   320
Symbols






: :** *** . : * : * :: : : *: *:**::: **



SGD_Scer_TTI2/YJR136C   321   EYIVRNPFYTTFPKLISKTLSVVSTLIKVCPNERIVAHRFDILSLILVTY   370
MIT_Smik_c740_12700   321   EYTVRNPFFSAFPKLVSKTLSVITTLIKVCPNERVVAHKFDILSLILITF   370
MIT_Spar_c310_12806   321   EYIVRNPFYSTFPKLVSKTLSVIGTLINICPNERIVAHKFDILSLILVTY   370
MIT_Suva_c603_13760   321   EYIVRSPFYTAFPKLISKTLSVIDILIKVCPQERIKAHKFDILSLILITY   370
WashU_Sbay_Contig558.5   321   EYIVRSPFYTAFPKLISKTLSVIDILIKVCPQERIKAHKFDILSLILITY   370
WashU_Scas_Contig719.77   313   EYIVKTPFLTLYKPLIISVLDVLQTLIHECAPERIIAHKYDILTILIIIY   362
WashU_Sklu_Contig2443.5   325   EYLVRNPFITVFMPILHKTLNVLSTLASACPKERVQAHKYDFLACAIILY   374
WashU_Skud_Contig1942.6   343   EYIVRNPFFTIFPELVSKALLVIDTLIEVCPNERIVAHKFDILSLILITF   392
WashU_Smik_Contig2828.6   321   EYTVRNPFFSAFPKLVSKTLSVITTLIKVCPNERVVAHKFDILSLILITF   370
Symbols






** *:.** : : :: ..* *: * *. **: **::*:*: :: :



SGD_Scer_TTI2/YJR136C   371   DKCSQEDALN-----------ESILQQCKETISWLLNCDCAMGEQLSTLS   409
MIT_Smik_c740_12700   371   DKCSQENALN-----------ESILQQCKDTIKWLLSYDCDMEDELSTLS   409
MIT_Spar_c310_12806   371   DKCSQEDALN-----------ESVLEQCKETIKRLLDCDCGMEDQLSTLS   409
MIT_Suva_c603_13760   371   DKCSQEDALN-----------ESIQLQCKGTMRGLLNYNCGMERELSSLS   409
WashU_Sbay_Contig558.5   371   DKCSQEDALN-----------ESIQLQCKGTMRGLLNYNCGMERELSSLS   409
WashU_Scas_Contig719.77   363   EKCSREGIMDDDKGVATVTPKETVDIEVTSKIRQMIFALELPANERIELL   412
WashU_Sklu_Contig2443.5   375   EKCDQEGTLQ-----------NDTLSLLNNYIRLLERRQCDFTQDKLTLL   413
WashU_Skud_Contig1942.6   393   DKCLQEDALN-----------EPTLLQCKRTMKSLLHCNCSMEGELSTLS   431
WashU_Smik_Contig2828.6   371   DKCSQENALN-----------ESILQQCKDTIKWLLSYDCDMEDELSTLS   409
Symbols






:** :*. :: : . : : : *



SGD_Scer_TTI2/YJR136C   410   KQPRFQLLFEFS   421
MIT_Smik_c740_12700   410   KQPRFHLLFQFS   421
MIT_Spar_c310_12806   410   KQPRFQLLFEFS   421
MIT_Suva_c603_13760   410   NQPRFRLLFESL   421
WashU_Sbay_Contig558.5   410   NQPRFRLLFESL   421
WashU_Scas_Contig719.77   413   KGRDIEALFTDN   424
WashU_Sklu_Contig2443.5   414   EKRNLSKLFPSN   425
WashU_Skud_Contig1942.6   432   EQPRFRLLFDFS   443
WashU_Smik_Contig2828.6   410   KQPRFHLLFQFS   421
Symbols






: : **



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_TTI2/YJR136C:

SGD_Scer_TTI2/YJR136C  Length: 422  Mon Nov  7 15:52:24 2016  Type: P  Check: 8744  ..

       1  MTAVTDIIDE LNDSSLSSTR LRELCLQLRK KTDTGCAITV SDEVNLIESL

      51  SYHSISPGVD IQINTDVLQT IDYYFQRNKS EHDEIMCVLI SKLQPLLLKR

     101  KSNFELKEQR NLGLKPTLGM SLKEDNLMQA WVSQGGLKGI PLFYVILLHL

     151  KRRDISTNLS WIIPGILNIL DDTTDIRRIK LRGVLLLQTL LNHTFMNETN

     201  DSKWIQFSST GLFPLFEKTL INMCYFLPPS YNADETIAIW RVVFPTIQSL

     251  YKVEFLDNYT KYQYHLEKFM SEIILQNIIP RASLAYENLT LYALECTMNI

     301  LRLQREGSVV HLQRLIFVLG EYIVRNPFYT TFPKLISKTL SVVSTLIKVC

     351  PNERIVAHRF DILSLILVTY DKCSQEDALN ESILQQCKET ISWLLNCDCA

     401  MGEQLSTLSK QPRFQLLFEF S*

Protein Sequence for MIT_Smik_c740_12700:

MIT_Smik_c740_12700  Length: 422  Mon Nov  7 15:52:24 2016  Type: P  Check: 8617  ..

       1  MTPIDDIISE LNELKISSAR LSELCLQLRE KVDTTCAITV ADEIKLIESL

      51  SYHSISSRLD IQINNDVLKT IDRYFQLSEG NYDGIMWGLI SALQPLLLKG

     101  KSNSGLKEQR NPGLKPTLGL SMKEDNITKA WVNQGGLKSI PLFYVILLYL

     151  KRKDVSTNLS WIIPGIINIL DDTTDIRKIK LRGVLLLKTL LDYTFMSEPD

     201  NPKWIQFSST GLFPLFEKTL INMCYFLPPS YSADETVAIW RIVFPTILAL

     251  YKVEFFADYT KYQYHLEKFM SGILLQNIIP RVSLAHENLT LYALETVSNM

     301  LKLQKEGSVV HLQRLIFVLG EYTVRNPFFS AFPKLVSKTL SVITTLIKVC

     351  PNERVVAHKF DILSLILITF DKCSQENALN ESILQQCKDT IKWLLSYDCD

     401  MEDELSTLSK QPRFHLLFQF S*

Protein Sequence for MIT_Spar_c310_12806:

MIT_Spar_c310_12806  Length: 422  Mon Nov  7 15:52:24 2016  Type: P  Check: 5379  ..

       1  MTVISDIIDE LNDSCFTPTR LPDLCFKLRE KANGACAITV ADEIKLIESL

      51  SYRSISPGLD IQINKDVLET IDQYFQRSKS RHDEIMGALI STLQPLLLKG

     101  KSHSELKEQH NLGLKPTLGM SLKEDNFIQT WVSQGGLKSI PLFYVILLHL

     151  KRKDISTNLS WIIPGILNIL DDTTDIRKIK LRGVLLLQTL LNHTFMNEIN

     201  DSKWIQFSNT GLFPLFEKTL INMCYFLPPS YNADETIAIW RIVFPTIHSL

     251  YRVEFFDDYT RYQYHLEKFM SEILLQSIIP RASVTYENLT LYALETATNI

     301  LKLQKEGSVV HLQRLIFVLG EYIVRNPFYS TFPKLVSKTL SVIGTLINIC

     351  PNERIVAHKF DILSLILVTY DKCSQEDALN ESVLEQCKET IKRLLDCDCG

     401  MEDQLSTLSK QPRFQLLFEF S*

Protein Sequence for MIT_Suva_c603_13760:

MIT_Suva_c603_13760  Length: 422  Mon Nov  7 15:52:24 2016  Type: P  Check: 5241  ..

       1  MTTISDITDE LNDPGLSFTR LSELCTQLQD GIDSRCGLTV KDEIKIIESL

      51  SYHSIHEGVD LQINKHVLKT IDCYFRRNAH DHDGIMQALI SSLQPLLLKG

     101  KSNSERKQQQ NLGLKPVLGM SLKEDQLKEV WIRQDGLKSI PLFYVILLHI

     151  KRKDVSTNLS WIIPGILNIL DDTTDLRKVK LRGVFLLQTA LDHTFMHEIN

     201  DSKWIQFSST GLFPLFEKAL INMCYFLPPS YDANETLAIW RLVFPTINSL

     251  YKVEFFDNKH KYQYHLEKFM SEILLQNIIP RASLNYENLT LYALETTATV

     301  LKLQKEGSVV HLQRLIYVLG EYIVRSPFYT AFPKLISKTL SVIDILIKVC

     351  PQERIKAHKF DILSLILITY DKCSQEDALN ESIQLQCKGT MRGLLNYNCG

     401  MERELSSLSN QPRFRLLFES L*

Protein Sequence for WashU_Sbay_Contig558.5:

WashU_Sbay_Contig558.5  Length: 422  Mon Nov  7 15:52:24 2016  Type: P  Check: 5241  ..

       1  MTTISDITDE LNDPGLSFTR LSELCTQLQD GIDSRCGLTV KDEIKIIESL

      51  SYHSIHEGVD LQINKHVLKT IDCYFRRNAH DHDGIMQALI SSLQPLLLKG

     101  KSNSERKQQQ NLGLKPVLGM SLKEDQLKEV WIRQDGLKSI PLFYVILLHI

     151  KRKDVSTNLS WIIPGILNIL DDTTDLRKVK LRGVFLLQTA LDHTFMHEIN

     201  DSKWIQFSST GLFPLFEKAL INMCYFLPPS YDANETLAIW RLVFPTINSL

     251  YKVEFFDNKH KYQYHLEKFM SEILLQNIIP RASLNYENLT LYALETTATV

     301  LKLQKEGSVV HLQRLIYVLG EYIVRSPFYT AFPKLISKTL SVIDILIKVC

     351  PQERIKAHKF DILSLILITY DKCSQEDALN ESIQLQCKGT MRGLLNYNCG

     401  MERELSSLSN QPRFRLLFES L*

Protein Sequence for WashU_Scas_Contig719.77:

WashU_Scas_Contig719.77  Length: 425  Mon Nov  7 15:52:24 2016  Type: P  Check: 1584  ..

       1  MNREPWQTFV DRCLNGKDIP TVTSDELQQL KKISLSADVV DSQELILALS

      51  YAIMSDPDEI IPLILQLTSP AFTKKMAVDC LIEQLQPLLL KVSNRKLKRE

     101  PMRLNNNNVD FRQDEQRTQW KQNGGMKSIP LIFTIIRLLD RSDISSNLGW

     151  LTPAMLNLLD DTSDLTGIKL KSVILLDEFL NKFNNDNVDD TDDDKWISFK

     201  DTGLFALYEP ILKLLCYYIP PMYTEKESLS TMQIAYPTLI KLYSTQFKKD

     251  TRMYKRKISE ILTELLLQNV IPRLDLKYDT LIIFSLQIMK QLITILQGQS

     301  IIHLQRIIYC LGEYIVKTPF LTLYKPLIIS VLDVLQTLIH ECAPERIIAH

     351  KYDILTILII IYEKCSREGI MDDDKGVATV TPKETVDIEV TSKIRQMIFA

     401  LELPANERIE LLKGRDIEAL FTDN*

Protein Sequence for WashU_Sklu_Contig2443.5:

WashU_Sklu_Contig2443.5  Length: 426  Mon Nov  7 15:52:24 2016  Type: P  Check: 7698  ..

       1  MMTERVELSR LLTEIDSQID DLPHEAQVED LCRALTQNKE IISQESLARC

      51  LQYLSYFTIN SLPWTTNEHL CHKCFSVISD FMTDDLLQVL IDRLRPMLLA

     101  IKNQKSSNSG RSRYTMGTGL KPKLGFGGEE DRIRDEWKRG GGLKSIPLFY

     151  VILSHLKSQN ISSNLWWITP GILNLLDDTS DIVGVKLQGV ALLKQFLETT

     201  IDLKDTSHFD FSQTGLFDAY QSILNSMCYY LPPSVDPKTT LTVWRAVYPT

     251  MLSLYRVQFY NEENIYCKHV KRFFSETILQ IAIPRVSTDH VELTSFLLDL

     301  TIEILNLLKE QSVSHMQRIL YTLGEYLVRN PFITVFMPIL HKTLNVLSTL

     351  ASACPKERVQ AHKYDFLACA IILYEKCDQE GTLQNDTLSL LNNYIRLLER

     401  RQCDFTQDKL TLLEKRNLSK LFPSN*

Protein Sequence for WashU_Skud_Contig1942.6:

WashU_Skud_Contig1942.6  Length: 444  Mon Nov  7 15:52:24 2016  Type: P  Check: 5307  ..

       1  MKTMKEMKTR RRAKNQKGTK KRMAKISDII DELVDTKLSP ARLSELCFQL

      51  RENVDDVYAT TMADEIKLIE SLSYLSLSPG TEIQINNDVI KTIDKRFQSG

     101  RNHYGDIVRG LISSLQPLLL KGKSNSELKG QQNLVLKPAL GMSLKEDNLR

     151  EVWIGQGGLK SIPLFYVVLL HLKRKDVSTN LSWIVPGILN ILDDTTDLRR

     201  IKLRGVLLLQ TLLDHTFVCE IDDSKWIQFS SIGLFPLLEK ILVNMCYFLP

     251  PSYNANDTLA IWRVVFPTIH SLYRVEFVND NTKYQYHLEK FMSEILLQNI

     301  IPRASLTYDN LTTYALETAT NILKLQKGGS VVHLQRLVYV LGEYIVRNPF

     351  FTIFPELVSK ALLVIDTLIE VCPNERIVAH KFDILSLILI TFDKCLQEDA

     401  LNEPTLLQCK RTMKSLLHCN CSMEGELSTL SEQPRFRLLF DFS*


Protein Sequence for WashU_Smik_Contig2828.6:

WashU_Smik_Contig2828.6  Length: 422  Mon Nov  7 15:52:24 2016  Type: P  Check: 9367  ..

       1  MTPIDDIISE LNELKISSAR LSELCLQLRE KVDTTCAITV ADEIKLIESL

      51  SYHSISSRLD IQINNDVLKT IDRYFQLSEG NYDGIMWGLI SALQPLLLKG

     101  KSNSGLKEQR NPGLKPTLGL SMKEDNITKA WVNQGGLKSI PLFYVILLYL

     151  KRKDVSTNLS WIIPGIINIL DNTTDIRKIK LRGVLLLKTL LDYTFMSEPD

     201  NPKWIQFSST GLFPLVEKTL INMCYFLPPS YSADETVAIW RIVFPTILAL

     251  YKVEFFADYT KYQYHLEKFM SGILLQNIIP RVSLAHENLT LYALGTVSNM

     301  LKLQKEGSVV HLQRLIFVLG EYTVRNPFFS AFPKLVSKTL SVITTLIKVC

     351  PNERVVAHKF DILSLILITF DKCSQENALN ESILQQCKDT IKWLLSYDCD

     401  MEDELSTLSK QPRFHLLFQF S*