Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YJR135W-A and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_TIM8/YJR135W-A   1   ----MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFK   46
MIT_Smik_c740_12698   1   ----MSSLSTSDLASLDDTSKREIATFLEGENSKQKVQMSIHQFTNTCFK   46
MIT_Spar_c310_12804   1   ----MSSLSTSDLASLDDTSKREIATFLEGENSKQKVQMSIHQFTNICFK   46
MIT_Suva_c603_13762   1   ----MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNTCFK   46
WashU_Sbay_Contig558.4   1   ----MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNTCFK   46
WashU_Scas_Contig719.76   1   MSLNNTTLASENLAALDDSSKKEIAAFLESENSKQKVQMSIHQLTNTCFK   50
WashU_Sklu_Contig2443.6   1   ----MSSITQADLANLDDGSKKDIMTFLESENSKQKVQMSIHQFTNICFK   46
WashU_Skud_Contig1942.5   1   ----MSSLSTSDLASLDDASKKEIATFLEGENSKQKVQMSIHQFTNICFK   46
WashU_Smik_Contig2828.5   1   ----MSSLSTSDLASLDDTSKREIATFLEGENSKQKVQMSIHQFTNTCFK   46
Symbols






:::: :** *** **::* :***.*************:** ***



SGD_Scer_TIM8/YJR135W-A   47   KCVESVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR   87
MIT_Smik_c740_12698   47   KCVESVNNPNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTH   87
MIT_Spar_c310_12804   47   KCVESVNDPNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR   87
MIT_Suva_c603_13762   47   KCVGSVNNPDLSSQEEQCLANCVNRFLDTNIRIVNGLQNTR   87
WashU_Sbay_Contig558.4   47   KCVGSVNNPDLSSQEEQCLANCVNRFLDTNIRIVNGLQNTR   87
WashU_Scas_Contig719.76   51   NCVSSITDSNLNAQEEECLSSCVNKFLDTNIRLVKGLQNSQ   91
WashU_Sklu_Contig2443.6   47   QCIPSVNNADLSTQEEQCLNNCVNRFLDTNIRIVKGLQSIQ   87
WashU_Skud_Contig1942.5   47   KCVDSVNNPDLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR   87
WashU_Smik_Contig2828.5   47   KCVESVNNPNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTH   87
Symbols






:*: *:.:.:*.:***:** .***:*******:*:***. :



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_TIM8/YJR135W-A:

SGD_Scer_TIM8/YJR135W-A  Length: 88  Mon Nov  7 15:52:22 2016  Type: P  Check: 3419  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for MIT_Smik_c740_12698:

MIT_Smik_c740_12698  Length: 88  Mon Nov  7 15:52:22 2016  Type: P  Check: 4093  ..

       1  MSSLSTSDLA SLDDTSKREI ATFLEGENSK QKVQMSIHQF TNTCFKKCVE

      51  SVNNPNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTH*

Protein Sequence for MIT_Spar_c310_12804:

MIT_Spar_c310_12804  Length: 88  Mon Nov  7 15:52:22 2016  Type: P  Check: 3380  ..

       1  MSSLSTSDLA SLDDTSKREI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDPNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for MIT_Suva_c603_13762:

MIT_Suva_c603_13762  Length: 88  Mon Nov  7 15:52:22 2016  Type: P  Check: 3645  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNTCFKKCVG

      51  SVNNPDLSSQ EEQCLANCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for WashU_Sbay_Contig558.4:

WashU_Sbay_Contig558.4  Length: 88  Mon Nov  7 15:52:22 2016  Type: P  Check: 3645  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNTCFKKCVG

      51  SVNNPDLSSQ EEQCLANCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for WashU_Scas_Contig719.76:

WashU_Scas_Contig719.76  Length: 92  Mon Nov  7 15:52:22 2016  Type: P  Check: 3976  ..

       1  MSLNNTTLAS ENLAALDDSS KKEIAAFLES ENSKQKVQMS IHQLTNTCFK

      51  NCVSSITDSN LNAQEEECLS SCVNKFLDTN IRLVKGLQNS Q*


Protein Sequence for WashU_Sklu_Contig2443.6:

WashU_Sklu_Contig2443.6  Length: 88  Mon Nov  7 15:52:22 2016  Type: P  Check: 2424  ..

       1  MSSITQADLA NLDDGSKKDI MTFLESENSK QKVQMSIHQF TNICFKQCIP

      51  SVNNADLSTQ EEQCLNNCVN RFLDTNIRIV KGLQSIQ*

Protein Sequence for WashU_Skud_Contig1942.5:

WashU_Skud_Contig1942.5  Length: 88  Mon Nov  7 15:52:22 2016  Type: P  Check: 2899  ..

       1  MSSLSTSDLA SLDDASKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVD

      51  SVNNPDLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for WashU_Smik_Contig2828.5:

WashU_Smik_Contig2828.5  Length: 88  Mon Nov  7 15:52:22 2016  Type: P  Check: 4093  ..

       1  MSSLSTSDLA SLDDTSKREI ATFLEGENSK QKVQMSIHQF TNTCFKKCVE

      51  SVNNPNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTH*