Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YJL180C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_ATP12/YJL180C   1   --------MLPSLRKGCFIVNSIRLKLPRFYSLNAQPLGTDNTIENNTPT   42
MIT_Smik_c834_11530   1   --------MLASLKNSYVVIRSIKSRLPRLYSLSAQPLGIDNTIENNSPT   42
MIT_Spar_c343_11973   1   --------MLASLKQGCSIVNPIRLTLPRFYSLSAQPLGIDNTIENNSLT   42
MIT_Suva_c328_12337   1   --------MLTSLKNGSCIARSIRSTIPRYYSLNAQPLGTDNTIENNSPT   42
WashU_Sbay_Contig648.15   1   --------MLTSLKNGSCIARSIRSTIPRYYSLNAQPLGTDNTIENNSPT   42
WashU_Scas_Contig634.1   1   MLKITTFTLRQSLRSSRCSNLNSIRRLTEGSLSTAVPLGADKTLENNLKT   50
WashU_Sklu_Contig1840.2   1   ---------MLRLAIAAKQPLATELLSTARTYATATPLGLDNTAENNLQT   41
WashU_Skud_Contig1825.5   1   --------MFASLKNGHCITRSVRSTLPRFYSSSAHSLGIDNTIENNSPT   42
WashU_Smik_Contig2218.4   1   --------MLASLKNSYVVIRSIKSRLPRLYSLSAQPLGIDNTIENNSPT   42
Symbols






* . . .* .** *:* *** *



SGD_Scer_ATP12/YJL180C   43   ETNRLSKTSQKFWEKVSLNRDVEKGKIALQLDGRTIKTPLGNGIIVDNAK   92
MIT_Smik_c834_11530   43   ETNRLSKTSQKFWEKVSLNRNVKKGKIALQLDGTTIKTPLGNEIIIDDTR   92
MIT_Spar_c343_11973   43   ETNRLSKTSQKFWEKVSLNRNLEKGKIALQLDGRTIKTPLGNGIIIDNSR   92
MIT_Suva_c328_12337   43   ETNRLSKTSQKFWEKVSLNRNSENGKIALQLDGKTIKTPLGNGIIIDDTR   92
WashU_Sbay_Contig648.15   43   ETNRLSKTSQKFWEKVSLNRNSENGKIALQLDGKTIKTPLGNGIIIDDTR   92
WashU_Scas_Contig634.1   51   ETNRLLKTGKKFWEDVKLNDKLLTDKISIEIDTKPIRTPLGNLLAVSKDK   100
WashU_Sklu_Contig1840.2   42   ETNRLSKTFAKFWDKVTLDR--SKNEITVYLDNKPIRTPLGNPLTVSNDR   89
WashU_Skud_Contig1825.5   43   ETNRLSKTSQKFWEKVSLNRDIENGKIALQLDGKTIKTPLGNGIIIDDTR   92
WashU_Smik_Contig2218.4   43   ETNRLSKTSQKFWEKVSLNRNVKKGKIALQLDGTTIKTPLGNEIIIDDTR   92
Symbols






***** ** ***:.*.*: ..:*:: :* .*:***** : :.. :



SGD_Scer_ATP12/YJL180C   93   SLLAYLLKLEWSSLSSLSIKTHSLPLTSLVARCIDLQMTNEPGCDPQLVA   142
MIT_Smik_c834_11530   93   SLLAYLLKLEWSSLSNISIKTHSLPLTSLVARSIDLQMINKPDCDPQLVA   142
MIT_Spar_c343_11973   93   SLLAYLLKLEWSSLSSLSIKTHSLPLTSLVARCIDLQTTNEPGCDPQLVA   142
MIT_Suva_c328_12337   93   SLLAYLLKLEWSSLSSLSIKTHSLPLTSLVSRCIDLETTNKPGCDPQLIA   142
WashU_Sbay_Contig648.15   93   SLLAYLLKLEWSSLSSLSIKTHSLPLTSLVSRCIDLETTNKPGCDPQLIA   142
WashU_Scas_Contig634.1   101   PLLAYLIRQEWATLTELSLNTDSMPLTSLVSRCIDLASTEEPGCDPNLIA   150
WashU_Sklu_Contig1840.2   90   QFLALMLHNEWANLPNLSIKPHSLPLTSVVSRCIDLEMTGKPECDPELVA   139
WashU_Skud_Contig1825.5   93   SLLAYLLKLEWSCLPSLSIKTHSLPLTSLVARCIDLQMTNKPGCSPQLIA   142
WashU_Smik_Contig2218.4   93   SSLSILIEAGVVIPYPTFSIQNPLPCHX----------------------   120
Symbols






*: ::. ..:*



SGD_Scer_ATP12/YJL180C   143   KIGGNSDVIKNQLLRYLDTDTLLVFSPMNEFEGRLRNAQNELYIPIIKGM   192
MIT_Smik_c834_11530   143   KIGGNSDVIKNQLLRYLDTDTLLVFSPMNEFEGKLRNAQNKSYLPLIKGM   192
MIT_Spar_c343_11973   143   KIGGNSDVIKNQLLRYLDTDTLLVFSPMNEYEGRLRNAQNELYLPLIKGM   192
MIT_Suva_c328_12337   143   KIGGNSDVIKNQLLRYLDTDTLLVFSPMSEFEGKLRTAQNELYLPLIKGT   192
WashU_Sbay_Contig648.15   143   KIGGNSDVIKNQLLRYLDTDTLLVFSPMSEFEGKLRTAQNELYLPLIKGT   192
WashU_Scas_Contig634.1   151   KIGADRNQINSDLLRYLDTDTLLVFSPRAELEGVLRADQDKLYLPIIQGI   200
WashU_Sklu_Contig1840.2   140   KVGGGRDKISNDLLRYLDTDTLLCFSPRAEYEGSLRAAQDKLYLPIIESM   189
WashU_Skud_Contig1825.5   143   KIGGTSDVIRNQLLRYLDTDTLLVFSPMSEFEGNLRIAQNESYQPLIKGM   192
WashU_Smik_Contig2218.4   
   --------------------------------------------------   
Symbols










SGD_Scer_ATP12/YJL180C   193   EEFLRNFSSES-NIRLQILDADIHGLRGNQQSDIVKNAAKKYMSSLSPWD   241
MIT_Smik_c834_11530   193   EEFLSKFSSQSNVQLQILDADIHG-LRGNQQSDIVKNAATKYMNGLSQWD   241
MIT_Spar_c343_11973   193   EEFLSSFSSES-NIRLQILDADIHGLRGNQQSDIVKNAATKYMSSLSPWD   241
MIT_Suva_c328_12337   193   EEFLSKFSSKHNVIHLQVLDADIHGLRGNQQSNVVRDAAMNYMNSLSPWD   242
WashU_Sbay_Contig648.15   193   EEFLSKFSSKHNVIHLQVLDADIHGLRGNQQSNVVRDAAMNYMNSLSPWD   242
WashU_Scas_Contig634.1   201   KQFLSDYRSHASPIKLRTLDADIHGLRGNMQSQETKDAAINYLNSLSLWD   250
WashU_Sklu_Contig1840.2   190   RALLSQYS--SEPVSLQILDADVHGLRGNAQTEQTRAAARRYLDTLSLWD   237
WashU_Skud_Contig1825.5   193   EEFLSRFSSNS-NIHLQVLDADIHGLRGNRQSDIVRNAAMKYMDSLSLWD   241
WashU_Smik_Contig2218.4   
   --------------------------------------------------   
Symbols










SGD_Scer_ATP12/YJL180C   242   LAILEKTVLTTKSFICGVLLLENKKDTANLIPALKTDMDNIVRAATLETI   291
MIT_Smik_c834_11530   242   LSILEKTILTTKSFICGVLLLENKKNSSNLLPNLKTDMESIIRAATLETI   291
MIT_Spar_c343_11973   242   LAILEKTVLTTKSFICGVLLLENKKNPADLSAILKTDMDDIIRAATLETI   291
MIT_Suva_c328_12337   243   LAILEKTVLTTKSFICGVLLMENKKISDNLPPGLKTDMEKIVRAATLETI   292
WashU_Sbay_Contig648.15   243   LAILEKTVLTTKSFICGVLLMENKKISDNLPPGLKTDMEKIVRAATLETI   292
WashU_Scas_Contig634.1   251   LAVFEKTVLVTKSFVCGILLLQNKASKTVPLKQLQVDAERIAHLATLEIT   300
WashU_Sklu_Contig1840.2   238   FAVFEKTVLTTKSFICAAMLLHNKS--ASGASRMELTMEEIAQAATLETI   285
WashU_Skud_Contig1825.5   242   LAILEKAVLTTKSFICGVLLLENKKDTNQLPPTLKTNMENIIRAATLETL   291
WashU_Smik_Contig2218.4   
   --------------------------------------------------   
Symbols










SGD_Scer_ATP12/YJL180C   292   FQVEKWGEVEDTHDVDKRDIRRKIHTAAIAAFKQ   325
MIT_Smik_c834_11530   292   FQVEKWGEVEDTHDVDKRDIRRKVYTAAIAAFTQ   325
MIT_Spar_c343_11973   292   FQVEKWGEVEDTHDVDKRDIRRKVHIAAIAAFKQ   325
MIT_Suva_c328_12337   293   FQIEKWGEVEDTHDVDKRDIKRKIHTAAIAAFKQ   326
WashU_Sbay_Contig648.15   293   FQIEKWGEVEDTHDVDKRDIKRKIHTAAIAAFKQ   326
WashU_Scas_Contig634.1   301   HQTRRWGEVEDTHDVNKVDIRRNIGVAAIAAFSM   334
WashU_Sklu_Contig1840.2   286   YQVERWGEVEDTHDVDKRDIRRNVTAAAIVAYKE   319
WashU_Skud_Contig1825.5   292   FQIEKWGEVEDTHDVDKRDIRRKIHTAAIAAFKQ   325
WashU_Smik_Contig2218.4   
   ----------------------------------   
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_ATP12/YJL180C:

SGD_Scer_ATP12/YJL180C  Length: 326  Mon Nov  7 15:48:37 2016  Type: P  Check: 5558  ..

       1  MLPSLRKGCF IVNSIRLKLP RFYSLNAQPL GTDNTIENNT PTETNRLSKT

      51  SQKFWEKVSL NRDVEKGKIA LQLDGRTIKT PLGNGIIVDN AKSLLAYLLK

     101  LEWSSLSSLS IKTHSLPLTS LVARCIDLQM TNEPGCDPQL VAKIGGNSDV

     151  IKNQLLRYLD TDTLLVFSPM NEFEGRLRNA QNELYIPIIK GMEEFLRNFS

     201  SESNIRLQIL DADIHGLRGN QQSDIVKNAA KKYMSSLSPW DLAILEKTVL

     251  TTKSFICGVL LLENKKDTAN LIPALKTDMD NIVRAATLET IFQVEKWGEV

     301  EDTHDVDKRD IRRKIHTAAI AAFKQ*

Protein Sequence for MIT_Smik_c834_11530:

MIT_Smik_c834_11530  Length: 326  Mon Nov  7 15:48:37 2016  Type: P  Check: 9405  ..

       1  MLASLKNSYV VIRSIKSRLP RLYSLSAQPL GIDNTIENNS PTETNRLSKT

      51  SQKFWEKVSL NRNVKKGKIA LQLDGTTIKT PLGNEIIIDD TRSLLAYLLK

     101  LEWSSLSNIS IKTHSLPLTS LVARSIDLQM INKPDCDPQL VAKIGGNSDV

     151  IKNQLLRYLD TDTLLVFSPM NEFEGKLRNA QNKSYLPLIK GMEEFLSKFS

     201  SQSNVQLQIL DADIHGLRGN QQSDIVKNAA TKYMNGLSQW DLSILEKTIL

     251  TTKSFICGVL LLENKKNSSN LLPNLKTDME SIIRAATLET IFQVEKWGEV

     301  EDTHDVDKRD IRRKVYTAAI AAFTQ*

Protein Sequence for MIT_Spar_c343_11973:

MIT_Spar_c343_11973  Length: 326  Mon Nov  7 15:48:37 2016  Type: P  Check: 4951  ..

       1  MLASLKQGCS IVNPIRLTLP RFYSLSAQPL GIDNTIENNS LTETNRLSKT

      51  SQKFWEKVSL NRNLEKGKIA LQLDGRTIKT PLGNGIIIDN SRSLLAYLLK

     101  LEWSSLSSLS IKTHSLPLTS LVARCIDLQT TNEPGCDPQL VAKIGGNSDV

     151  IKNQLLRYLD TDTLLVFSPM NEYEGRLRNA QNELYLPLIK GMEEFLSSFS

     201  SESNIRLQIL DADIHGLRGN QQSDIVKNAA TKYMSSLSPW DLAILEKTVL

     251  TTKSFICGVL LLENKKNPAD LSAILKTDMD DIIRAATLET IFQVEKWGEV

     301  EDTHDVDKRD IRRKVHIAAI AAFKQ*

Protein Sequence for MIT_Suva_c328_12337:

MIT_Suva_c328_12337  Length: 327  Mon Nov  7 15:48:37 2016  Type: P  Check: 2524  ..

       1  MLTSLKNGSC IARSIRSTIP RYYSLNAQPL GTDNTIENNS PTETNRLSKT

      51  SQKFWEKVSL NRNSENGKIA LQLDGKTIKT PLGNGIIIDD TRSLLAYLLK

     101  LEWSSLSSLS IKTHSLPLTS LVSRCIDLET TNKPGCDPQL IAKIGGNSDV

     151  IKNQLLRYLD TDTLLVFSPM SEFEGKLRTA QNELYLPLIK GTEEFLSKFS

     201  SKHNVIHLQV LDADIHGLRG NQQSNVVRDA AMNYMNSLSP WDLAILEKTV

     251  LTTKSFICGV LLMENKKISD NLPPGLKTDM EKIVRAATLE TIFQIEKWGE

     301  VEDTHDVDKR DIKRKIHTAA IAAFKQ*

Protein Sequence for WashU_Sbay_Contig648.15:

WashU_Sbay_Contig648.15  Length: 327  Mon Nov  7 15:48:37 2016  Type: P  Check: 2524  ..

       1  MLTSLKNGSC IARSIRSTIP RYYSLNAQPL GTDNTIENNS PTETNRLSKT

      51  SQKFWEKVSL NRNSENGKIA LQLDGKTIKT PLGNGIIIDD TRSLLAYLLK

     101  LEWSSLSSLS IKTHSLPLTS LVSRCIDLET TNKPGCDPQL IAKIGGNSDV

     151  IKNQLLRYLD TDTLLVFSPM SEFEGKLRTA QNELYLPLIK GTEEFLSKFS

     201  SKHNVIHLQV LDADIHGLRG NQQSNVVRDA AMNYMNSLSP WDLAILEKTV

     251  LTTKSFICGV LLMENKKISD NLPPGLKTDM EKIVRAATLE TIFQIEKWGE

     301  VEDTHDVDKR DIKRKIHTAA IAAFKQ*

Protein Sequence for WashU_Scas_Contig634.1:

WashU_Scas_Contig634.1  Length: 335  Mon Nov  7 15:48:37 2016  Type: P  Check: 5703  ..

       1  MLKITTFTLR QSLRSSRCSN LNSIRRLTEG SLSTAVPLGA DKTLENNLKT

      51  ETNRLLKTGK KFWEDVKLND KLLTDKISIE IDTKPIRTPL GNLLAVSKDK

     101  PLLAYLIRQE WATLTELSLN TDSMPLTSLV SRCIDLASTE EPGCDPNLIA

     151  KIGADRNQIN SDLLRYLDTD TLLVFSPRAE LEGVLRADQD KLYLPIIQGI

     201  KQFLSDYRSH ASPIKLRTLD ADIHGLRGNM QSQETKDAAI NYLNSLSLWD

     251  LAVFEKTVLV TKSFVCGILL LQNKASKTVP LKQLQVDAER IAHLATLEIT

     301  HQTRRWGEVE DTHDVNKVDI RRNIGVAAIA AFSM*

Protein Sequence for WashU_Sklu_Contig1840.2:

WashU_Sklu_Contig1840.2  Length: 320  Mon Nov  7 15:48:37 2016  Type: P  Check: 4332  ..

       1  MLRLAIAAKQ PLATELLSTA RTYATATPLG LDNTAENNLQ TETNRLSKTF

      51  AKFWDKVTLD RSKNEITVYL DNKPIRTPLG NPLTVSNDRQ FLALMLHNEW

     101  ANLPNLSIKP HSLPLTSVVS RCIDLEMTGK PECDPELVAK VGGGRDKISN

     151  DLLRYLDTDT LLCFSPRAEY EGSLRAAQDK LYLPIIESMR ALLSQYSSEP

     201  VSLQILDADV HGLRGNAQTE QTRAAARRYL DTLSLWDFAV FEKTVLTTKS

     251  FICAAMLLHN KSASGASRME LTMEEIAQAA TLETIYQVER WGEVEDTHDV

     301  DKRDIRRNVT AAAIVAYKE*

Protein Sequence for WashU_Skud_Contig1825.5:

WashU_Skud_Contig1825.5  Length: 326  Mon Nov  7 15:48:37 2016  Type: P  Check: 7904  ..

       1  MFASLKNGHC ITRSVRSTLP RFYSSSAHSL GIDNTIENNS PTETNRLSKT

      51  SQKFWEKVSL NRDIENGKIA LQLDGKTIKT PLGNGIIIDD TRSLLAYLLK

     101  LEWSCLPSLS IKTHSLPLTS LVARCIDLQM TNKPGCSPQL IAKIGGTSDV

     151  IRNQLLRYLD TDTLLVFSPM SEFEGNLRIA QNESYQPLIK GMEEFLSRFS

     201  SNSNIHLQVL DADIHGLRGN RQSDIVRNAA MKYMDSLSLW DLAILEKAVL

     251  TTKSFICGVL LLENKKDTNQ LPPTLKTNME NIIRAATLET LFQIEKWGEV

     301  EDTHDVDKRD IRRKIHTAAI AAFKQ*

Protein Sequence for WashU_Smik_Contig2218.4:

WashU_Smik_Contig2218.4  Length: 120  Mon Nov  7 15:48:37 2016  Type: P  Check: 8023  ..

       1  MLASLKNSYV VIRSIKSRLP RLYSLSAQPL GIDNTIENNS PTETNRLSKT

      51  SQKFWEKVSL NRNVKKGKIA LQLDGTTIKT PLGNEIIIDD TRSSLSILIE

     101  AGVVIPYPTF SIQNPLPCHX