Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YIL117C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_PRM5/YIL117C   1   MTVITIAKRGLPKLTTSTSSTTTASSSSTITSVASSSSSL-----PLLS-   44
MIT_Smik_c390_10714   1   MTKITISKRGLPKLTTATSSTAASS-----TTTAVSSSSP-----SFLSS   40
MIT_Spar_c440_10652   1   MTVITIAKRGLPKLTTAASSTTTTSSTSTITSAASSSSSS-----SFLSS   45
MIT_Suva_c482_11779   1   MAIMTVIKRGLPKLTTTATSTTAATSTAAATSTGSITSAASTYSSASFSS   50
WashU_Sbay_Contig665.16   1   ---MTVIKRGLPKLTTTATSTTAATSTAAATSTGSITSAASTYSSASFSS   47
WashU_Skud_Contig1925.4   1   MTLITINKRGLPKLTTASTATTASSTS--IITSAVSSSSS-----ALPSS   43
WashU_Smik_Contig1594.1   1   MTKITISKRGLPKLTTATSSTAASS-----TTTAVSSSSP-----SFLSS   40
Symbols






:*: *********::::*:::: : . :*: . *



SGD_Scer_PRM5/YIL117C   45   NSTSSSIIPSITPPSRNGNPYILDSGDMPNGTVFIVVGGIAGVIFLAILL   94
MIT_Smik_c390_10714   41   NSTSSSIIPNITPPSKNGNPYILDSSSMPNGTVFIIVGAIAGAIFLAILL   90
MIT_Spar_c440_10652   46   NSTTSSITSSITPPSKNGNPYILDSGNMPNGTIFIIVGAIAGAIFLAILL   95
MIT_Suva_c482_11779   51   NSTSSSFTSSITPPSINGNPYIIGTSSVPSGTVFIIVGAIVGAIFLAILV   100
WashU_Sbay_Contig665.16   48   NSTSSSFTSSITPPSINGNPYIIGTSSVPSGTVFIIVGAIVGAIFLAILV   97
WashU_Skud_Contig1925.4   44   NSTSSSVIPSITPPSKNGNPYIIDSGSMPNGTVFIIVGAIAGAIFLAILL   93
WashU_Smik_Contig1594.1   41   NSTSSSIIPNITPPSKNGNPYILDSSSMPNGTVFIIVGAIAGAIFLAILL   90
Symbols






***:**. ..***** ******:.:..:*.**:**:**.*.*.******:



SGD_Scer_PRM5/YIL117C   95   WWVITTYSSHRLTRSVQDYESKMFSTQHTQFYGDSPYMDYPAKENFQDQV   144
MIT_Smik_c390_10714   91   WWVMVTYSSRRLTRSVQDYESKMFSTQHTQTYGDSPYLDHSAQDNSQGNV   140
MIT_Spar_c440_10652   96   WWVITTYSSHRLTRSVQDYESKMFSTQHTQFYGDSPYMDYPAKDNFQDQV   145
MIT_Suva_c482_11779   101   WWTMVTYSSHKLTKSVQDYESKMFSSQHTQYYGDSPYQDFSANDHAQDHA   150
WashU_Sbay_Contig665.16   98   WWTMVTYSSHKLTKSVQDYESKMFSSQHTQYYGDSPYQDFSANDHAQDHA   147
WashU_Skud_Contig1925.4   94   WWIIVTYSSHRLTKSVQDYESKMFSTQHTQNYGDSSYTDLSAKGLYQDHP   143
WashU_Smik_Contig1594.1   91   WWVMVTYSSRRLTRSVQDYESKMFSTQHTQTYGDSPYLDHSAQDNSQGNV   140
Symbols






** :.****::**:***********:**** ****.* * .*: *.:



SGD_Scer_PRM5/YIL117C   145   HISESDISPGNKDESVKDALVSHTNNEKPFLSNFERPLFSLASESNRNSL   194
MIT_Smik_c390_10714   141   NIHDSDEYHGNKDESAKNVLIPYNINEKVLSSNFERPLSSIVSASNRNSL   190
MIT_Spar_c440_10652   146   HIRDSDMASGNKHESVNNALVSHTINEKALLSNFERPLSSLVSESNRNSL   195
MIT_Suva_c482_11779   151   HDRDGDNHIDRDDSVKIGLISHDVNEKVTAPIDFERSFSGLVSNSNRNSL   200
WashU_Sbay_Contig665.16   148   HDRDGDNHIDRDDSVKIGLISHDVNEKVTAPIDFERSFSGLVSNSNRNSL   197
WashU_Skud_Contig1925.4   144   HDRFDDSDAENKDESAKIALVYHNVNEKILSSNFERPISPLVSNSNRNSL   193
WashU_Smik_Contig1594.1   141   NIHDSDEYHGNKDESAKNVLIPYNINEKVLSSNFERPLSSIVSASNRNSL   190
Symbols






: .* .... : :: :***.: :.* ******



SGD_Scer_PRM5/YIL117C   195   FISPTGDILYKTRLSKLYQESPRLLQKPVIMTSDNVSTNSLVSTISSSSA   244
MIT_Smik_c390_10714   191   FISPTGDILNKTRLSKLYQETPQLLQKPLIAKSSNLSSSSLVSTISSSSL   240
MIT_Spar_c440_10652   196   FISPTGDILNKTRLSKLYQESPRLLQKPLIMRSDNVSSNSLVSTISSSST   245
MIT_Suva_c482_11779   201   FISPTGDILNQTRLSKLYQESPRLIQKPFTMTSNSASSNSLVSTVSSSST   250
WashU_Sbay_Contig665.16   198   FISPTGDILNQTRLSKLYQESPRLIQKPFTMTSNSASSNSLVSTVSSSST   247
WashU_Skud_Contig1925.4   194   FISPTGDILNKTRLSKLYQESPKLLQKPLVATSNNASSNSLISTISSSSI   243
WashU_Smik_Contig1594.1   191   FISPTGDILNKTRLSKLYQETPQLLQKPLIAKSSNLSSSSLVSTISSSSL   240
Symbols






********* :*********:*:*:***. *.. *:.**:**:****



SGD_Scer_PRM5/YIL117C   245   SSLDNGN--EKEVGEDIRKPAKIASSPSRKLLNSPESDGSVNRNHSKGNL   292
MIT_Smik_c390_10714   241   SSLDNNNDNEKRMGEDIRKPAKIAASPSRKLLNSPESDTSSSSRSNNGNL   290
MIT_Spar_c440_10652   246   SSLDNGG--EKEVGEDIKKPAKIAASPSRKLLSSSGSDHSLKSKHSKVNL   293
MIT_Suva_c482_11779   251   SSLDNAN--EKKTAEDIKKPAKLAVSPHRKVQSSPGSDNSSKNSRSRGNL   298
WashU_Sbay_Contig665.16   248   SSLDNAN--EKKTAEDIKKPAKLAVSPHRKVQSSPGSDNSSKNSRSRGNL   295
WashU_Skud_Contig1925.4   244   SSTDNGN--EKKIEEDMKKPARIAASPNRKLSGSPGSNDSSKSQRSKGSS   291
WashU_Smik_Contig1594.1   241   SSLDNNNDNEKRMGEDIRKPAKIAASPSRKLLNSPESDTSSSSRSNNGNL   290
Symbols






** ** . **. **::***::* ** **: .*. *: * . .. .



SGD_Scer_PRM5/YIL117C   293   LVVQSKRKPTPSTYLEHMLEGKEQDE   318
MIT_Smik_c390_10714   291   LNIQSKRKVTPSTYLEHMLEGERQDE   316
MIT_Spar_c440_10652   294   LAVRSKRKPTPSTYLEHMLEGKQQDE   319
MIT_Suva_c482_11779   299   LTVEARRKATPSTYLEDMLEGKET--   322
WashU_Sbay_Contig665.16   296   LTVEARRKATPSTYLEDMLEGKET--   319
WashU_Skud_Contig1925.4   292   LAVQPKRKATPSTYLEDMLEGKQQDE   317
WashU_Smik_Contig1594.1   291   LNIQSKRKVTPSTYLEHMLEGERQDE   316
Symbols






* :..:** *******.****:.



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_PRM5/YIL117C:

SGD_Scer_PRM5/YIL117C  Length: 319  Mon Nov  7 15:42:12 2016  Type: P  Check: 9135  ..

       1  MTVITIAKRG LPKLTTSTSS TTTASSSSTI TSVASSSSSL PLLSNSTSSS

      51  IIPSITPPSR NGNPYILDSG DMPNGTVFIV VGGIAGVIFL AILLWWVITT

     101  YSSHRLTRSV QDYESKMFST QHTQFYGDSP YMDYPAKENF QDQVHISESD

     151  ISPGNKDESV KDALVSHTNN EKPFLSNFER PLFSLASESN RNSLFISPTG

     201  DILYKTRLSK LYQESPRLLQ KPVIMTSDNV STNSLVSTIS SSSASSLDNG

     251  NEKEVGEDIR KPAKIASSPS RKLLNSPESD GSVNRNHSKG NLLVVQSKRK

     301  PTPSTYLEHM LEGKEQDE*

Protein Sequence for MIT_Smik_c390_10714:

MIT_Smik_c390_10714  Length: 317  Mon Nov  7 15:42:12 2016  Type: P  Check: 3832  ..

       1  MTKITISKRG LPKLTTATSS TAASSTTTAV SSSSPSFLSS NSTSSSIIPN

      51  ITPPSKNGNP YILDSSSMPN GTVFIIVGAI AGAIFLAILL WWVMVTYSSR

     101  RLTRSVQDYE SKMFSTQHTQ TYGDSPYLDH SAQDNSQGNV NIHDSDEYHG

     151  NKDESAKNVL IPYNINEKVL SSNFERPLSS IVSASNRNSL FISPTGDILN

     201  KTRLSKLYQE TPQLLQKPLI AKSSNLSSSS LVSTISSSSL SSLDNNNDNE

     251  KRMGEDIRKP AKIAASPSRK LLNSPESDTS SSSRSNNGNL LNIQSKRKVT

     301  PSTYLEHMLE GERQDE*

Protein Sequence for MIT_Spar_c440_10652:

MIT_Spar_c440_10652  Length: 320  Mon Nov  7 15:42:12 2016  Type: P  Check: 751  ..

       1  MTVITIAKRG LPKLTTAASS TTTTSSTSTI TSAASSSSSS SFLSSNSTTS

      51  SITSSITPPS KNGNPYILDS GNMPNGTIFI IVGAIAGAIF LAILLWWVIT

     101  TYSSHRLTRS VQDYESKMFS TQHTQFYGDS PYMDYPAKDN FQDQVHIRDS

     151  DMASGNKHES VNNALVSHTI NEKALLSNFE RPLSSLVSES NRNSLFISPT

     201  GDILNKTRLS KLYQESPRLL QKPLIMRSDN VSSNSLVSTI SSSSTSSLDN

     251  GGEKEVGEDI KKPAKIAASP SRKLLSSSGS DHSLKSKHSK VNLLAVRSKR

     301  KPTPSTYLEH MLEGKQQDE*

Protein Sequence for MIT_Suva_c482_11779:

MIT_Suva_c482_11779  Length: 323  Mon Nov  7 15:42:12 2016  Type: P  Check: 5363  ..

       1  MAIMTVIKRG LPKLTTTATS TTAATSTAAA TSTGSITSAA STYSSASFSS

      51  NSTSSSFTSS ITPPSINGNP YIIGTSSVPS GTVFIIVGAI VGAIFLAILV

     101  WWTMVTYSSH KLTKSVQDYE SKMFSSQHTQ YYGDSPYQDF SANDHAQDHA

     151  HDRDGDNHID RDDSVKIGLI SHDVNEKVTA PIDFERSFSG LVSNSNRNSL

     201  FISPTGDILN QTRLSKLYQE SPRLIQKPFT MTSNSASSNS LVSTVSSSST

     251  SSLDNANEKK TAEDIKKPAK LAVSPHRKVQ SSPGSDNSSK NSRSRGNLLT

     301  VEARRKATPS TYLEDMLEGK ET*

Protein Sequence for WashU_Sbay_Contig665.16:

WashU_Sbay_Contig665.16  Length: 320  Mon Nov  7 15:42:12 2016  Type: P  Check: 8169  ..

       1  MTVIKRGLPK LTTTATSTTA ATSTAAATST GSITSAASTY SSASFSSNST

      51  SSSFTSSITP PSINGNPYII GTSSVPSGTV FIIVGAIVGA IFLAILVWWT

     101  MVTYSSHKLT KSVQDYESKM FSSQHTQYYG DSPYQDFSAN DHAQDHAHDR

     151  DGDNHIDRDD SVKIGLISHD VNEKVTAPID FERSFSGLVS NSNRNSLFIS

     201  PTGDILNQTR LSKLYQESPR LIQKPFTMTS NSASSNSLVS TVSSSSTSSL

     251  DNANEKKTAE DIKKPAKLAV SPHRKVQSSP GSDNSSKNSR SRGNLLTVEA

     301  RRKATPSTYL EDMLEGKET*

Protein Sequence for WashU_Skud_Contig1925.4:

WashU_Skud_Contig1925.4  Length: 318  Mon Nov  7 15:42:12 2016  Type: P  Check: 2361  ..

       1  MTLITINKRG LPKLTTASTA TTASSTSIIT SAVSSSSSAL PSSNSTSSSV

      51  IPSITPPSKN GNPYIIDSGS MPNGTVFIIV GAIAGAIFLA ILLWWIIVTY

     101  SSHRLTKSVQ DYESKMFSTQ HTQNYGDSSY TDLSAKGLYQ DHPHDRFDDS

     151  DAENKDESAK IALVYHNVNE KILSSNFERP ISPLVSNSNR NSLFISPTGD

     201  ILNKTRLSKL YQESPKLLQK PLVATSNNAS SNSLISTISS SSISSTDNGN

     251  EKKIEEDMKK PARIAASPNR KLSGSPGSND SSKSQRSKGS SLAVQPKRKA

     301  TPSTYLEDML EGKQQDE*

Protein Sequence for WashU_Smik_Contig1594.1:

WashU_Smik_Contig1594.1  Length: 317  Mon Nov  7 15:42:12 2016  Type: P  Check: 3832  ..

       1  MTKITISKRG LPKLTTATSS TAASSTTTAV SSSSPSFLSS NSTSSSIIPN

      51  ITPPSKNGNP YILDSSSMPN GTVFIIVGAI AGAIFLAILL WWVMVTYSSR

     101  RLTRSVQDYE SKMFSTQHTQ TYGDSPYLDH SAQDNSQGNV NIHDSDEYHG

     151  NKDESAKNVL IPYNINEKVL SSNFERPLSS IVSASNRNSL FISPTGDILN

     201  KTRLSKLYQE TPQLLQKPLI AKSSNLSSSS LVSTISSSSL SSLDNNNDNE

     251  KRMGEDIRKP AKIAASPSRK LLNSPESDTS SSSRSNNGNL LNIQSKRKVT

     301  PSTYLEHMLE GERQDE*