Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YHR186C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_KOG1/YHR186C   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
MIT_Smik_c662_10319   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHRTN   50
MIT_Spar_c30_9674   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHRTN   50
MIT_Suva_c224_11166   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSEQLLQSLANDFIFYFDDKRHRTN   50
WashU_Sbay_Contig644.7   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSEQLLQSLANDFIFYFDDKRHRTN   50
WashU_Scas_Contig684.14   1   MPVTYGPQPLKPLNTQMRHGFEEQYDT-QFIQSLVNNFIFYFDDKRHRTN   49
Symbols






** *********** *********:: *::***.*:**********:**



SGD_Scer_KOG1/YHR186C   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
MIT_Smik_c662_10319   51   GNPIPEEHKQRDINGYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
MIT_Spar_c30_9674   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
MIT_Suva_c224_11166   51   GNPIPDEDKQKDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
WashU_Sbay_Contig644.7   51   GNPIPDEDKQKDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
WashU_Scas_Contig684.14   50   GNPIPQAIKLQDKDHYYQTISDWKIMKDRQKTVSAALLLCLNLGVDPPDL   99
Symbols






*****: * :* : ***.*:****************************:



SGD_Scer_KOG1/YHR186C   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
MIT_Smik_c662_10319   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
MIT_Spar_c30_9674   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
MIT_Suva_c224_11166   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
WashU_Sbay_Contig644.7   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
WashU_Scas_Contig684.14   100   VKTHPCARMESWVDPLNFQDSKKAIEQIGKNLQSQYETLSLRCRYKQSLD   149
Symbols






:*******:*:**********************:******** *******



SGD_Scer_KOG1/YHR186C   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
MIT_Smik_c662_10319   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
MIT_Spar_c30_9674   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
MIT_Suva_c224_11166   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
WashU_Sbay_Contig644.7   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
WashU_Scas_Contig684.14   150   PCVEDVKRFCNSLRRSSKDDRILFHYNGHGVPQPTPSGEIWVFNRGYTQY   199
Symbols






***************:**:*************:** **************



SGD_Scer_KOG1/YHR186C   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
MIT_Smik_c662_10319   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
MIT_Spar_c30_9674   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIRDDEEGNHDV   250
MIT_Suva_c224_11166   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEDGNHDV   250
WashU_Sbay_Contig644.7   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEDGNHDV   250
WashU_Scas_Contig684.14   200   IPVSIYDLQSWLGAPCVYVYDCNSAGNIVTNFQKFVQKRIKDDQEGNHDA   249
Symbols






****:****:******::******* **: **********:**::****.



SGD_Scer_KOG1/YHR186C   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
MIT_Smik_c662_10319   251   AAPSPTSAYLDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
MIT_Spar_c30_9674   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
MIT_Suva_c224_11166   251   AAPSPTPAYEDCFQLASCRSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
WashU_Sbay_Contig644.7   251   AAPSPTPAYEDCFQLASCRSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
WashU_Scas_Contig684.14   250   AAPSPTAAYLQCFQLASCRANELLLMSPELPADLFTCCLTCPIEISIRIF   299
Symbols






******.** :******* ::**************:**************



SGD_Scer_KOG1/YHR186C   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
MIT_Smik_c662_10319   301   LMQSPLKDSKYKIFFENATSNQPFGDGKNSFKPKIPNVNIPGMLSDRRTP   350
MIT_Spar_c30_9674   301   LMQSPLKDSKYKIFFENATSKQPFGDSRNSFKSKIPNVNIPGMLSDRRTP   350
MIT_Suva_c224_11166   301   LMQSPLKDSKYKVFFENATSNQSFADSRNSFKSKIPNVNIPGMLSDRRTP   350
WashU_Sbay_Contig644.7   301   LMQSPLKDSKYKVFFENATSNQSFADSRNSFKSKIPNVNIPGMLSDRRTP   350
WashU_Scas_Contig684.14   300   LMQSPLKHSKYKIFFESTSNDS----NTESFKANVPTVSIPGVLSDRRTP   345
Symbols






*******.****:***.::... . :***.::*.*.***:*******



SGD_Scer_KOG1/YHR186C   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
MIT_Smik_c662_10319   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
MIT_Spar_c30_9674   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
MIT_Suva_c224_11166   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
WashU_Sbay_Contig644.7   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
WashU_Scas_Contig684.14   346   LGELNWIFTAVTDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   395
Symbols






**********:***************************************



SGD_Scer_KOG1/YHR186C   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
MIT_Smik_c662_10319   401   WYNCHPVSDPKLPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
MIT_Spar_c30_9674   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVTDLKNAPPATALE   450
MIT_Suva_c224_11166   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
WashU_Sbay_Contig644.7   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
WashU_Scas_Contig684.14   396   WYNCHPISDPELPDSIADHPMWKSWDLAMDEVLGKLVTELKNSPPTSDLE   445
Symbols






******:***:*****: *************** *:* :***:**:: **



SGD_Scer_KOG1/YHR186C   451   SQMILQQQETLQ----NGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLV   496
MIT_Smik_c662_10319   451   SQMILQQQETLQ----NNGNSKSNVQDTKAGSIQTQSRFAVANLSTMSLV   496
MIT_Spar_c30_9674   451   SQMILQQQETLQ----NSGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLV   496
MIT_Suva_c224_11166   451   SQMILQQQETLQ----NGGSSKPNLQDTKAGSMQTQSRFAVANLSTMSLV   496
WashU_Sbay_Contig644.7   451   SQMILQQQETLQ----NGGSSKPNLQDTKAGSMQTQSRFAVANLSTMSLV   496
WashU_Scas_Contig684.14   446   KQLILQQNDVNSGITQQSAKVQPGKQKIQPESIQTQSKFAVSNLSTISLV   495
Symbols






.*:****::. . :... :.. *. :. *:****:***:****:***



SGD_Scer_KOG1/YHR186C   497   NNPALQS---RKSISLQSSQQQLQQQQQQQQQ-FTGFFEQNLTAFELWLK   542
MIT_Smik_c662_10319   497   NNPALQS---RKSISFQSTQQQLQQQLQ--QQQFTGFFEQNLTAFELWLK   541
MIT_Spar_c30_9674   497   NNPALQS---RKSISLQSSQQQLQQQQQQQQQQFTGFFEQNLTAFELWLK   543
MIT_Suva_c224_11166   497   NNSAAQS---RKSISLQTSQQTQQQQQQ-----FTGFFEQNLTAFELWLK   538
WashU_Sbay_Contig644.7   497   NNSAAQS---RKSISLQTSQQTQQQQQQ-----FTGFFEQNLTAFELWLK   538
WashU_Scas_Contig684.14   496   NHPALQNQGKKVQNVVLPSNSQQSQQQQQQQQQFTGFFEQNLTAFELWLK   545
Symbols






*:.* *. : . . .::. .** * *****************



SGD_Scer_KOG1/YHR186C   543   YASNVRHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIG   592
MIT_Smik_c662_10319   542   YASNVRHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIG   591
MIT_Spar_c30_9674   544   YASNVRHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIG   593
MIT_Suva_c224_11166   539   YASNVRHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIG   588
WashU_Sbay_Contig644.7   539   YASNVRHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIG   588
WashU_Scas_Contig684.14   546   YASNSRHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIG   595
Symbols






**** *********************************************



SGD_Scer_KOG1/YHR186C   593   IFPYVLKLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVT   642
MIT_Smik_c662_10319   592   IFPYVLKLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVT   641
MIT_Spar_c30_9674   594   IFPYVLKLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFIT   643
MIT_Suva_c224_11166   589   IFPYVLKLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFIT   638
WashU_Sbay_Contig644.7   589   IFPYVLKLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFIT   638
WashU_Scas_Contig684.14   596   IFPYVLKLLQSPAPELKPILVFIWARIMSIDYKNTQAELIKERGYIYFIS   645
Symbols






************************************:*****:**:**::



SGD_Scer_KOG1/YHR186C   643   VLVPDWGVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRT   692
MIT_Smik_c662_10319   642   VLVPDWGVNGASTTNGPAVMNGGNPLTMTASQNINGPSSRYHERQQNSRS   691
MIT_Spar_c30_9674   644   VLVPDWGVNGVSTVNGSAMINGGNPLTMTASQNINGPSSRYYDRQQGNRT   693
MIT_Suva_c224_11166   639   VLVPDWGVSGPSPTNGSAMMNGGNPLTMTASQNINAPRSRYYDQQQANRT   688
WashU_Sbay_Contig644.7   639   VLVPDWGVSGPSPTNGSAMMNGGNPLTMTASQNINAPRSRYYDQQQANRT   688
WashU_Scas_Contig684.14   646   ILVPEWGYN--LTPSRSTSFINGVPMTPTTPTTPSLPMG-----------   682
Symbols






:***:** . . . .: : .* *:* *:. . . * .



SGD_Scer_KOG1/YHR186C   693   SNLGHNNLPFYHSNDTTDEQKAMAVFVLASFVRNFPLGQKNCFSLELVNK   742
MIT_Smik_c662_10319   692   SNLGHNNLSFYHSNDTTDEQKAMAVFVLASFVRNFPLGQKNCFSLELVNK   741
MIT_Spar_c30_9674   694   SNFGHNNLPFYHSNDTTDEQKAMAVFVLASFVRNFPLGQKNCFSLELVNK   743
MIT_Suva_c224_11166   689   PNMGHSSLPFYHSNDTTDEQKAMAVFVLASFVRDFPLGQKNCFSLELVSK   738
WashU_Sbay_Contig644.7   689   PNMGHSSLPFYHSNDTTDEQKAMAVFVLASFVRDFPLGQKNCFSLELVSK   738
WashU_Scas_Contig684.14   683   -------AQPPHANDTTDEQKAMAVFVLASFVRDYKPGQKLCFSLELITK   725
Symbols






*:********************:: *** ******:.*



SGD_Scer_KOG1/YHR186C   743   LCFYIDNSEIPLLRQWCVILLGLLFADNPLNRFVCMNTGAVEILLKSLKD   792
MIT_Smik_c662_10319   742   LCFYIENSEIPLLRQWCVILLGLLFADNPLDRFVCMNTGAIEILLKTLKD   791
MIT_Spar_c30_9674   744   LCFYIENSEIPLLRQWCVILLGLLFADNPLDRFVCMNTGAVEILLKSLKD   793
MIT_Suva_c224_11166   739   LCFYIENSEIPLLRQWCIILLGLLFADNPLNRFVCMNTGAVEILLKSLKD   788
WashU_Sbay_Contig644.7   739   LCFYIENSEIPLLRQWCIILLGLLFADNPLNRFVCMNTGAVEILLKSLKD   788
WashU_Scas_Contig684.14   726   LSFYIDNSDIPLLRQWCILLIGLLYIQNPLNKFMCMNNGTLETLLLTLKD   775
Symbols






*.***:**:********::*:***: :***::*:***.*::* ** :***



SGD_Scer_KOG1/YHR186C   793   PVPEVRTASIFALKHFISGFQDAEVILRLQQEFEEQYQQLHSQLQHLQNQ   842
MIT_Smik_c662_10319   792   PVPEVRTASIFALKHFISGFQDSEVILRLQQEFEEQYQQLHSQLQHLQNQ   841
MIT_Spar_c30_9674   794   PVPEVRTASIFALKHFISGFQDAEIILRLQQEFEEQYQQSHSQLQHLQNQ   843
MIT_Suva_c224_11166   789   PVSEVRTASIFALKHFISGFQDSEAILRLQQEFEQQYQQLHSQLQHLQNQ   838
WashU_Sbay_Contig644.7   789   PVSEVRTASIFALKHFISGFQDSEAILRLQQEFEQQYQQLHSQLQHLQNQ   838
WashU_Scas_Contig684.14   776   PVPEVRTAVILTLKHFISDLDDADIIIRTQQEYEQQISQIHAQLQQLQNS   825
Symbols






**.***** *::******.::*:: *:* ***:*:* .* *:***:***.



SGD_Scer_KOG1/YHR186C   843   SHLQQQQ-SQQQQQHLEQQQMKIEKQIRHCQVMQNQLEVIDLRKLKRQEI   891
MIT_Smik_c662_10319   842   AHLQQQQ-SQQQQQHLEQQQMKIEKQIRHCQVMQSQLEVTDLRKLKRQEI   890
MIT_Spar_c30_9674   844   SHLQQQQ-SQQQQQHLEQQQMKIEKQIRHCQVMQNQLEVIDLRKLKRQEI   892
MIT_Suva_c224_11166   839   SHVQQQQQSQQQQQHLEQQQMKIEKQIRHCQVMQNQLENIDLRKLKRQEI   888
WashU_Sbay_Contig644.7   839   SHVQQQQQSQQQQQHLEQQQMKIEKQIRHCQVMQNQLENIDLRKLKRQEI   888
WashU_Scas_Contig684.14   826   --------PQQQQHNVEQQQLKLEQQLNHIQLMESQLENVELIKLKQQEL   867
Symbols






.****:::****:*:*:*:.* *:*:.*** :* ***:**:



SGD_Scer_KOG1/YHR186C   892   GNLISILPLINDGSSLVRKELVVYFSHIVSRYSNFFIVVVFNDLLEEIKL   941
MIT_Smik_c662_10319   891   GNLISILPLINDGSPLVRKELVIYFSQIVNRYSNFFIVVVFNDMLEEIKL   940
MIT_Spar_c30_9674   893   ANLISILPLINDGSPLVRKELVVYFSHIVNRYSNFFIVVVFNDLLEEIKL   942
MIT_Suva_c224_11166   889   ADLISILPLINDGSPLVRKELIIYFSLIVNRYSNFFIVVVFNDLLEEIKQ   938
WashU_Sbay_Contig644.7   889   ADLISILPLINDGSPLVRKELIIYFSLIVNRYSNFFIVVVFNDLLEEIKQ   938
WashU_Scas_Contig684.14   868   SNLIATLALINDGSPLVRKEVIIFFSQIVYRYTNFFLVVVFNELTDEISQ   917
Symbols






.:**: *.******.*****::::** ** **:***:*****:: :**.



SGD_Scer_KOG1/YHR186C   942   LEKSDINTRN---TSDKYSVSQGSIFYTVWKSLLILAEDPFLENKELSKQ   988
MIT_Smik_c662_10319   941   LEKNDVNTRS---ASDKYSVSHGSIFYTVWKSLLILAEDSFLENKELSKQ   987
MIT_Spar_c30_9674   943   LEKSDINTRN---TSDKYSVSHGSIFYTVWKSLLILAEDPFLENKELSKQ   989
MIT_Suva_c224_11166   939   LEKSDINTRN---ASDKYSVSHGSIFYTVWKSLLILAEDPFLENKELSKQ   985
WashU_Sbay_Contig644.7   939   LEKSDINTRN---ASDKYSVSHGSIFYTVWKSLLILAEDPFLENKELSKQ   985
WashU_Scas_Contig684.14   918   LEGKDMEQSKPNYGENRHSVSHGSVFSTVWKALLILAEDPYLENKKMAEQ   967
Symbols






** .*:: . .:::***:**:* ****:*******.:****::::*



SGD_Scer_KOG1/YHR186C   989   VIDYILLELSAHKELGGPFAVMEKFLLKRSSKAHQTGKFGFNSSQVQFVK   1038
MIT_Smik_c662_10319   988   VVDYILLELSVHKELGGPFAIMERFLLKRSSKANQTGKFGFNSSQVQFVK   1037
MIT_Spar_c30_9674   990   VIDYILLELSVHKELGGPFAVMEKFLLKRSSKANQSGKFGFNSSQVQFVK   1039
MIT_Suva_c224_11166   986   VIDHILLELSVHKELGGTFEVMEKFLLKRSSKANQNGKFGFNSSQVQFVK   1035
WashU_Sbay_Contig644.7   986   VIDHILLELSVHKELGGTFEVMEKFLLKRSSKANQNGKFGFNSSQVQFVK   1035
WashU_Scas_Contig684.14   968   VVDYILLELSSQNELGSVFGKIEHYLVKRSTQMTGTTNLNFNATQIQIGK   1017
Symbols






*:*:****** ::***. * :*::*:***:: . ::.**::*:*: *



SGD_Scer_KOG1/YHR186C   1039   SSLRSFSPNERVDNN-AFKKEQQQHDPKISHPMRTSLAKLFQSLGFSESN   1087
MIT_Smik_c662_10319   1038   SSLRSFSPNGRVDDN-ALKKEQYHHDLKTSHPIQVSLTKFFQNLGFSEVN   1086
MIT_Spar_c30_9674   1040   SSLRSFSPNERVDNN-TPKKEQHQHDLKASHPIQTSLAKLFQSLGFSESY   1088
MIT_Suva_c224_11166   1036   SSLRSFSPNGRIDNNNKSKKEQHQRDPKVSHPIQMSISKLFQNLGFSEAN   1085
WashU_Sbay_Contig644.7   1036   SSLRSFSPNGRIDNNNKSKKEQHQRDPKVSHPIQMSISKLFQNLGFSEAN   1085
WashU_Scas_Contig684.14   1018   NTLRQFNKNKETDSSLNNNTNNLNSN---DPDRFVTLSRLFKKLGFGEPT   1064
Symbols






.:**.*. * . *.. :.:: : : . :::::*:.***.*



SGD_Scer_KOG1/YHR186C   1088   SDSDTQSSNTSMKSHTSKKGPSGLYLLNGNNNIYPTAETPRFRKHTEPLQ   1137
MIT_Smik_c662_10319   1087   GDRDTQSSGASMKSHTSKKGPSALYLMNDNNSLYPTAGTPRFHKYTGPLK   1136
MIT_Spar_c30_9674   1089   GGRDTQSSNASMKSHTSKKGPPGLYLLNGNNNLYPTAGTPRFRKHTGPLQ   1138
MIT_Suva_c224_11166   1086   NDNDTLSSSTSMKSNSTKKGASGLYLSNGSNNLYPTAATPRFRRYTEPLN   1135
WashU_Sbay_Contig644.7   1086   NDNDTLSSSTSMKSNSTKKGASGLYLSNGSNNLYPTAATPRFRRYTEPLN   1135
WashU_Scas_Contig684.14   1065   LESDS----------VRAKKPSNIHLLGAAYGTSYTVQTPFFLEHKEQLP   1104
Symbols






*: * .. ::* . . *. ** * .:. *



SGD_Scer_KOG1/YHR186C   1138   LPLNSSFLDYSREYFQEPQMKKQEADEPGSVEYNARLWRRNRNETIIQET   1187
MIT_Smik_c662_10319   1137   MPLNSTFLDYSREYFQEPQMKKQEADEPGSVEYNARLWRRNRNETIIQET   1186
MIT_Spar_c30_9674   1139   LPLNSTFLDYSREYFQEPQMKKQESDEPGSVEYNARLWRRNRNETIIQET   1188
MIT_Suva_c224_11166   1136   MPLQSTFLDYSREYFQEPQMRKQEADEPGSVEYNARLWRRNRNETIIQET   1185
WashU_Sbay_Contig644.7   1136   MPLQSTFLDYSREYFQEPQMRKQEADEPGSVEYNARLWRRNRNETIIQET   1185
WashU_Scas_Contig684.14   1105   LPLESRFFDYSCEYFQEPQMRKPESDEVGSLEYNSRLWRRNRNEKIIEET   1154
Symbols






:**:* *:*** ********:* *:** **:***:*********.**:**



SGD_Scer_KOG1/YHR186C   1188   QGEKKLSIYGNWSKKLISLNNKSQPKLMKFAQFEDQLITADDRSTITVFD   1237
MIT_Smik_c662_10319   1187   QGEKKLSIYGNWSKRLISLNNKTQPKLMKFSQFEDQLITADDRSTITVFD   1236
MIT_Spar_c30_9674   1189   QGEKKLSIYGNWSKKLISLNNKSQPKLMKFTQFEDQLITADDRSTITVFD   1238
MIT_Suva_c224_11166   1186   QGEKKLSIYGNWSKRFISLNNKSQPKLMKFTQFEDQLVTADDRSTITVFD   1235
WashU_Sbay_Contig644.7   1186   QGEKKLSIYGNWSKRFISLNNKSQPKLMKFTQFEDQLVTADDRSTITVFD   1235
WashU_Scas_Contig684.14   1155   QKQKKLSLYGNWNNKIAILDNKTQPKVLKFTQFEDYLVSADDRDNITVFD   1204
Symbols






* :****:****.::: *:**:***::**:**** *::****..*****



SGD_Scer_KOG1/YHR186C   1238   WEKGKTLSKFSNGTPFGTKVTDLKLINEDDSALLLTGSSDGVIKIYRDYQ   1287
MIT_Smik_c662_10319   1237   WERGRVLSKFSNGTPFGTKVTDLKLINEDDSALLLTGSSDGIIKIYRNYQ   1286
MIT_Spar_c30_9674   1239   WGKGKTLSKFSNGTPFGTKVTDLKLINEDDSALLLTGSSDGVIKIYRDYQ   1288
MIT_Suva_c224_11166   1236   WEKGKTLSKFSNGTPFGTKVTDLKFINEDDSALLLAGSSDGVIKIYRNYH   1285
WashU_Sbay_Contig644.7   1236   WEKGKTLSKFSNGTPFGTKVTDLKFINEDDSALLLAGSSDGVIKIYRNYH   1285
WashU_Scas_Contig684.14   1205   WENKTRLNRFSNSNPFGTKITDLKFLNEDDITLLLTASSDGIIKVYRNFQ   1254
Symbols






* . *.:***..*****:****::**** :***:.****:**:**:::



SGD_Scer_KOG1/YHR186C   1288   DVDTFKIVSAWRGLTDMLLTPRSTGLLTEWLQIRGSLLTTGDVKVIRVWD   1337
MIT_Smik_c662_10319   1287   DIDTFEIVSAWRGLTDMLLTPRSTGLLTEWLQIRGSLLTTGDVKVIRVWD   1336
MIT_Spar_c30_9674   1289   DVDTFKIVSAWRGLTDMLLTPRSTGLLTEWLQIRGSLLTTGDVKVIRVWD   1338
MIT_Suva_c224_11166   1286   DIDNFEIVSAWRGLTDMLLTPRSTGLLTEWLQIRGSLLTTGDVKIIRVWD   1335
WashU_Sbay_Contig644.7   1286   DIDNFEIVSAWRGLTDMLLTPRSTGLLTEWLQIRGSLLTTGDVKIIRVWD   1335
WashU_Scas_Contig684.14   1255   SKDDVQEISACRALTDMLLAPRSSGLLTEWQQIRGSLLATGDVKIIRVWD   1304
Symbols






. * .: :** *.******:***:****** *******:*****:*****



SGD_Scer_KOG1/YHR186C   1338   AHTETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADGSLRVYDRRLDPR   1387
MIT_Smik_c662_10319   1337   AHTETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADGSLRVYDRRLDPR   1386
MIT_Spar_c30_9674   1339   AHTETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADGSLRVYDRRLDPR   1388
MIT_Suva_c224_11166   1336   AHTETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADGSLRVYDRRLDPR   1385
WashU_Sbay_Contig644.7   1336   AHTETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADGSLRVYDRRLDPR   1385
WashU_Scas_Contig684.14   1305   AHTETVEVDIPAKTSSLITALTSDQLAGDIFTAGFADGSLRVYDRRMDSR   1354
Symbols






*******************:**:*****:**.**************:*.*



SGD_Scer_KOG1/YHR186C   1388   DSMIRRWRAGNDKQGVWINNVHLQRGGYRELVSGATNGVVELWDIRSEDP   1437
MIT_Smik_c662_10319   1387   DSMIRRWRAGNEKQGVWINNVHLQRGGYRELVSGATNGAVELWDIRSEDP   1436
MIT_Spar_c30_9674   1389   DSMIRRWRAGNEKQGVWINNVHLQRGGYRELVSGATNGVVELWDIRSEDP   1438
MIT_Suva_c224_11166   1386   DSMIRRWRAGNEKQGVWINNVHLQRGGYRELVSGATNGVVELWDIRSEDP   1435
WashU_Sbay_Contig644.7   1386   DSMIRRWRAGNEKQGVWINNVHLQRGGYRELVSGATNGVVELWDIRSEDP   1435
WashU_Scas_Contig684.14   1355   DSMVRRWRAGNGVHGTWINNVHLQRGGYRELVSSTTNGVVQLWDIRSQEP   1404
Symbols






***:******* :*.*****************.:***.*:******::*



SGD_Scer_KOG1/YHR186C   1438   VESFVDQNVTSQYGSQQKPTTMTCMQVHEHAPIIATGTKQIKIWTTSGDL   1487
MIT_Smik_c662_10319   1437   VESFVDQNVTSQYGSQQKPTTMTCMQVHEHAPIIATGTKQIKIWTTSGDL   1486
MIT_Spar_c30_9674   1439   VESFVDQNVTSQYGSQQKPTTMTCMQVHEHAPIIATGTKQIKIWTTSGDL   1488
MIT_Suva_c224_11166   1436   VESFVDQNVVSQYGSQQKPTTMTCMQVHEHAPIIATGTKQIKIWTTSGDL   1485
WashU_Sbay_Contig644.7   1436   VESFVDQNVVSQYGSQQKPTTMTCMQVHEHAPIIATGTKQIKIWTTSGDL   1485
WashU_Scas_Contig684.14   1405   VQTFVDE---NSHGNQKKDTTMTCMQVHEHAPIIATGTRQLKIWTTSGDL   1451
Symbols






*::***: ..:*.*:* *******************:*:*********



SGD_Scer_KOG1/YHR186C   1488   LNSFKN--SHNNGVTSTLAATGIPKSLSYSSTSDAFLSSMAFHPHRMMIA   1535
MIT_Smik_c662_10319   1487   LNSFKN--SHNNGVTSTLAATGIPKSLSYSSTSDAFLSSMAFHPHRMMIA   1534
MIT_Spar_c30_9674   1489   LNSFKN--THNNGVTSTLAATGIPTSLSYSSTSDAFLSSMAFHPHRMMIA   1536
MIT_Suva_c224_11166   1486   LNSFKN--SHTNGVTSTLAATGIPKSLSYSSTSDAFLSSMAFHPHRMMIA   1533
WashU_Sbay_Contig644.7   1486   LNSFKN--SHTNGVTSTLAATGIPKSLSYSSTSDAFLSSMAFHPHRMMIA   1533
WashU_Scas_Contig684.14   1452   IANFKNNRGVSGGMANTLAASGIGSSLSYSGSSNSFLSSMTFHPHRMLLA   1501
Symbols






: .*** ..*::.****:** .*****.:*::*****:******::*



SGD_Scer_KOG1/YHR186C   1536   ATNSHDSIVNIYKCEDERIDYF   1557
MIT_Smik_c662_10319   1535   ATNSHDSVVNIYKCEDERIDYF   1556
MIT_Spar_c30_9674   1537   ATNSHDSVVNIYKCEDEKIDYF   1558
MIT_Suva_c224_11166   1534   ATNSHDSVVNIYKCEDERIDYF   1555
WashU_Sbay_Contig644.7   1534   ATNSHDSVVNIYKCEDERIDYF   1555
WashU_Scas_Contig684.14   1502   TNNSHDASISVYKCQDKKVAEY   1523
Symbols






:.****: :.:***:*::: :



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_KOG1/YHR186C:

SGD_Scer_KOG1/YHR186C  Length: 1558  Mon Nov  7 15:38:51 2016  Type: P  Check: 3628  ..

       1  MPEIYGPQPL KPLNTVMRHG FEEQYQSDQL LQSLANDFIF YFDDKRHKTN

      51  GNPIPEEDKQ RDVNRYYQPI TDWKIMKDRQ KTVSAALLLC LNLGVDPPDV

     101  MKTHPCARVE AWVDPLNFQD SKKAIEQIGK NLQAQYETLS LRTRYKQSLD

     151  PCVEDVKRFC NSLRRTSKED RILFHYNGHG VPKPTKSGEI WVFNRGYTQY

     201  IPVSLYDLQT WLGAPCIFVY DCNSAENILI NFQKFVQKRI KDDEEGNHDV

     251  AAPSPTSAYQ DCFQLASCTS DELLLMSPEL PADLFSCCLT CPIEISIRIF

     301  LMQSPLKDSK YKIFFENSTS NQPFGDSKNS FKSKIPNVNI PGMLSDRRTP

     351  LGELNWIFTA ITDTIAWTSL PRPLFKKLFR HDLMIAALFR NFLLAKRIMP

     401  WYNCHPVSDP ELPDSITTHP MWKSWDLAMD EVLTKIVIDL KNAPPATALE

     451  SQMILQQQET LQNGGSSKSN AQDTKAGSIQ TQSRFAVANL STMSLVNNPA

     501  LQSRKSISLQ SSQQQLQQQQ QQQQQFTGFF EQNLTAFELW LKYASNVRHP

     551  PEQLPIVLQV LLSQVHRIRA LVLLSRFLDL GPWAVYLSLS IGIFPYVLKL

     601  LQSPAPELKP ILVFIWARIM SIDYKNTQSE LIKEKGYMYF VTVLVPDWGV

     651  NGMSATNGSA MINSGNPLTM TASQNINGPS SRYYERQQGN RTSNLGHNNL

     701  PFYHSNDTTD EQKAMAVFVL ASFVRNFPLG QKNCFSLELV NKLCFYIDNS

     751  EIPLLRQWCV ILLGLLFADN PLNRFVCMNT GAVEILLKSL KDPVPEVRTA

     801  SIFALKHFIS GFQDAEVILR LQQEFEEQYQ QLHSQLQHLQ NQSHLQQQQS

     851  QQQQQHLEQQ QMKIEKQIRH CQVMQNQLEV IDLRKLKRQE IGNLISILPL

     901  INDGSSLVRK ELVVYFSHIV SRYSNFFIVV VFNDLLEEIK LLEKSDINTR

     951  NTSDKYSVSQ GSIFYTVWKS LLILAEDPFL ENKELSKQVI DYILLELSAH

    1001  KELGGPFAVM EKFLLKRSSK AHQTGKFGFN SSQVQFVKSS LRSFSPNERV

    1051  DNNAFKKEQQ QHDPKISHPM RTSLAKLFQS LGFSESNSDS DTQSSNTSMK

    1101  SHTSKKGPSG LYLLNGNNNI YPTAETPRFR KHTEPLQLPL NSSFLDYSRE

    1151  YFQEPQMKKQ EADEPGSVEY NARLWRRNRN ETIIQETQGE KKLSIYGNWS

    1201  KKLISLNNKS QPKLMKFAQF EDQLITADDR STITVFDWEK GKTLSKFSNG

    1251  TPFGTKVTDL KLINEDDSAL LLTGSSDGVI KIYRDYQDVD TFKIVSAWRG

    1301  LTDMLLTPRS TGLLTEWLQI RGSLLTTGDV KVIRVWDAHT ETVEVDIPAK

    1351  TSSLITSLTA DQLAGNIFVA GFADGSLRVY DRRLDPRDSM IRRWRAGNDK

    1401  QGVWINNVHL QRGGYRELVS GATNGVVELW DIRSEDPVES FVDQNVTSQY

    1451  GSQQKPTTMT CMQVHEHAPI IATGTKQIKI WTTSGDLLNS FKNSHNNGVT

    1501  STLAATGIPK SLSYSSTSDA FLSSMAFHPH RMMIAATNSH DSIVNIYKCE

    1551  DERIDYF*

Protein Sequence for MIT_Smik_c662_10319:

MIT_Smik_c662_10319  Length: 1557  Mon Nov  7 15:38:51 2016  Type: P  Check: 1033  ..

       1  MPEIYGPQPL KPLNTVMRHG FEEQYQSDQL LQSLANDFIF YFDDKRHRTN

      51  GNPIPEEHKQ RDINGYYQPI TDWKIMKDRQ KTVSAALLLC LNLGVDPPDV

     101  MKTHPCARVE AWVDPLNFQD SKKAIEQIGK NLQAQYETLS LRTRYKQSLD

     151  PCVEDVKRFC NSLRRTSKED RILFHYNGHG VPKPTKSGEI WVFNRGYTQY

     201  IPVSLYDLQT WLGAPCIFVY DCNSAENILI NFQKFVQKRI KDDEEGNHDV

     251  AAPSPTSAYL DCFQLASCTS DELLLMSPEL PADLFSCCLT CPIEISIRIF

     301  LMQSPLKDSK YKIFFENATS NQPFGDGKNS FKPKIPNVNI PGMLSDRRTP

     351  LGELNWIFTA ITDTIAWTSL PRPLFKKLFR HDLMIAALFR NFLLAKRIMP

     401  WYNCHPVSDP KLPDSITTHP MWKSWDLAMD EVLTKIVIDL KNAPPATALE

     451  SQMILQQQET LQNNGNSKSN VQDTKAGSIQ TQSRFAVANL STMSLVNNPA

     501  LQSRKSISFQ STQQQLQQQL QQQQFTGFFE QNLTAFELWL KYASNVRHPP

     551  EQLPIVLQVL LSQVHRIRAL VLLSRFLDLG PWAVYLSLSI GIFPYVLKLL

     601  QSPAPELKPI LVFIWARIMS IDYKNTQSEL IKEKGYMYFV TVLVPDWGVN

     651  GASTTNGPAV MNGGNPLTMT ASQNINGPSS RYHERQQNSR SSNLGHNNLS

     701  FYHSNDTTDE QKAMAVFVLA SFVRNFPLGQ KNCFSLELVN KLCFYIENSE

     751  IPLLRQWCVI LLGLLFADNP LDRFVCMNTG AIEILLKTLK DPVPEVRTAS

     801  IFALKHFISG FQDSEVILRL QQEFEEQYQQ LHSQLQHLQN QAHLQQQQSQ

     851  QQQQHLEQQQ MKIEKQIRHC QVMQSQLEVT DLRKLKRQEI GNLISILPLI

     901  NDGSPLVRKE LVIYFSQIVN RYSNFFIVVV FNDMLEEIKL LEKNDVNTRS

     951  ASDKYSVSHG SIFYTVWKSL LILAEDSFLE NKELSKQVVD YILLELSVHK

    1001  ELGGPFAIME RFLLKRSSKA NQTGKFGFNS SQVQFVKSSL RSFSPNGRVD

    1051  DNALKKEQYH HDLKTSHPIQ VSLTKFFQNL GFSEVNGDRD TQSSGASMKS

    1101  HTSKKGPSAL YLMNDNNSLY PTAGTPRFHK YTGPLKMPLN STFLDYSREY

    1151  FQEPQMKKQE ADEPGSVEYN ARLWRRNRNE TIIQETQGEK KLSIYGNWSK

    1201  RLISLNNKTQ PKLMKFSQFE DQLITADDRS TITVFDWERG RVLSKFSNGT

    1251  PFGTKVTDLK LINEDDSALL LTGSSDGIIK IYRNYQDIDT FEIVSAWRGL

    1301  TDMLLTPRST GLLTEWLQIR GSLLTTGDVK VIRVWDAHTE TVEVDIPAKT

    1351  SSLITSLTAD QLAGNIFVAG FADGSLRVYD RRLDPRDSMI RRWRAGNEKQ

    1401  GVWINNVHLQ RGGYRELVSG ATNGAVELWD IRSEDPVESF VDQNVTSQYG

    1451  SQQKPTTMTC MQVHEHAPII ATGTKQIKIW TTSGDLLNSF KNSHNNGVTS

    1501  TLAATGIPKS LSYSSTSDAF LSSMAFHPHR MMIAATNSHD SVVNIYKCED

    1551  ERIDYF*

Protein Sequence for MIT_Spar_c30_9674:

MIT_Spar_c30_9674  Length: 1559  Mon Nov  7 15:38:51 2016  Type: P  Check: 6556  ..

       1  MPEIYGPQPL KPLNTVMRHG FEEQYQSDQL LQSLANDFIF YFDDKRHRTN

      51  GNPIPEEDKQ RDVNRYYQPI TDWKIMKDRQ KTVSAALLLC LNLGVDPPDV

     101  MKTHPCARVE AWVDPLNFQD SKKAIEQIGK NLQAQYETLS LRTRYKQSLD

     151  PCVEDVKRFC NSLRRTSKED RILFHYNGHG VPKPTKSGEI WVFNRGYTQY

     201  IPVSLYDLQT WLGAPCIFVY DCNSAENILI NFQKFVQKRI RDDEEGNHDV

     251  AAPSPTSAYQ DCFQLASCTS DELLLMSPEL PADLFSCCLT CPIEISIRIF

     301  LMQSPLKDSK YKIFFENATS KQPFGDSRNS FKSKIPNVNI PGMLSDRRTP

     351  LGELNWIFTA ITDTIAWTSL PRPLFKKLFR HDLMIAALFR NFLLAKRIMP

     401  WYNCHPVSDP ELPDSITTHP MWKSWDLAMD EVLTKIVTDL KNAPPATALE

     451  SQMILQQQET LQNSGSSKSN AQDTKAGSIQ TQSRFAVANL STMSLVNNPA

     501  LQSRKSISLQ SSQQQLQQQQ QQQQQQFTGF FEQNLTAFEL WLKYASNVRH

     551  PPEQLPIVLQ VLLSQVHRIR ALVLLSRFLD LGPWAVYLSL SIGIFPYVLK

     601  LLQSPAPELK PILVFIWARI MSIDYKNTQS ELIKEKGYMY FITVLVPDWG

     651  VNGVSTVNGS AMINGGNPLT MTASQNINGP SSRYYDRQQG NRTSNFGHNN

     701  LPFYHSNDTT DEQKAMAVFV LASFVRNFPL GQKNCFSLEL VNKLCFYIEN

     751  SEIPLLRQWC VILLGLLFAD NPLDRFVCMN TGAVEILLKS LKDPVPEVRT

     801  ASIFALKHFI SGFQDAEIIL RLQQEFEEQY QQSHSQLQHL QNQSHLQQQQ

     851  SQQQQQHLEQ QQMKIEKQIR HCQVMQNQLE VIDLRKLKRQ EIANLISILP

     901  LINDGSPLVR KELVVYFSHI VNRYSNFFIV VVFNDLLEEI KLLEKSDINT

     951  RNTSDKYSVS HGSIFYTVWK SLLILAEDPF LENKELSKQV IDYILLELSV

    1001  HKELGGPFAV MEKFLLKRSS KANQSGKFGF NSSQVQFVKS SLRSFSPNER

    1051  VDNNTPKKEQ HQHDLKASHP IQTSLAKLFQ SLGFSESYGG RDTQSSNASM

    1101  KSHTSKKGPP GLYLLNGNNN LYPTAGTPRF RKHTGPLQLP LNSTFLDYSR

    1151  EYFQEPQMKK QESDEPGSVE YNARLWRRNR NETIIQETQG EKKLSIYGNW

    1201  SKKLISLNNK SQPKLMKFTQ FEDQLITADD RSTITVFDWG KGKTLSKFSN

    1251  GTPFGTKVTD LKLINEDDSA LLLTGSSDGV IKIYRDYQDV DTFKIVSAWR

    1301  GLTDMLLTPR STGLLTEWLQ IRGSLLTTGD VKVIRVWDAH TETVEVDIPA

    1351  KTSSLITSLT ADQLAGNIFV AGFADGSLRV YDRRLDPRDS MIRRWRAGNE

    1401  KQGVWINNVH LQRGGYRELV SGATNGVVEL WDIRSEDPVE SFVDQNVTSQ

    1451  YGSQQKPTTM TCMQVHEHAP IIATGTKQIK IWTTSGDLLN SFKNTHNNGV

    1501  TSTLAATGIP TSLSYSSTSD AFLSSMAFHP HRMMIAATNS HDSVVNIYKC

    1551  EDEKIDYF*

Protein Sequence for MIT_Suva_c224_11166:

MIT_Suva_c224_11166  Length: 1556  Mon Nov  7 15:38:51 2016  Type: P  Check: 550  ..

       1  MPEIYGPQPL KPLNTVMRHG FEEQYQSEQL LQSLANDFIF YFDDKRHRTN

      51  GNPIPDEDKQ KDVNRYYQPI TDWKIMKDRQ KTVSAALLLC LNLGVDPPDV

     101  MKTHPCARVE AWVDPLNFQD SKKAIEQIGK NLQAQYETLS LRTRYKQSLD

     151  PCVEDVKRFC NSLRRTSKED RILFHYNGHG VPKPTKSGEI WVFNRGYTQY

     201  IPVSLYDLQT WLGAPCIFVY DCNSAENILI NFQKFVQKRI KDDEDGNHDV

     251  AAPSPTPAYE DCFQLASCRS DELLLMSPEL PADLFSCCLT CPIEISIRIF

     301  LMQSPLKDSK YKVFFENATS NQSFADSRNS FKSKIPNVNI PGMLSDRRTP

     351  LGELNWIFTA ITDTIAWTSL PRPLFKKLFR HDLMIAALFR NFLLAKRIMP

     401  WYNCHPVSDP ELPDSITTHP MWKSWDLAMD EVLTKIVIDL KNAPPATALE

     451  SQMILQQQET LQNGGSSKPN LQDTKAGSMQ TQSRFAVANL STMSLVNNSA

     501  AQSRKSISLQ TSQQTQQQQQ QFTGFFEQNL TAFELWLKYA SNVRHPPEQL

     551  PIVLQVLLSQ VHRIRALVLL SRFLDLGPWA VYLSLSIGIF PYVLKLLQSP

     601  APELKPILVF IWARIMSIDY KNTQSELIKE KGYMYFITVL VPDWGVSGPS

     651  PTNGSAMMNG GNPLTMTASQ NINAPRSRYY DQQQANRTPN MGHSSLPFYH

     701  SNDTTDEQKA MAVFVLASFV RDFPLGQKNC FSLELVSKLC FYIENSEIPL

     751  LRQWCIILLG LLFADNPLNR FVCMNTGAVE ILLKSLKDPV SEVRTASIFA

     801  LKHFISGFQD SEAILRLQQE FEQQYQQLHS QLQHLQNQSH VQQQQQSQQQ

     851  QQHLEQQQMK IEKQIRHCQV MQNQLENIDL RKLKRQEIAD LISILPLIND

     901  GSPLVRKELI IYFSLIVNRY SNFFIVVVFN DLLEEIKQLE KSDINTRNAS

     951  DKYSVSHGSI FYTVWKSLLI LAEDPFLENK ELSKQVIDHI LLELSVHKEL

    1001  GGTFEVMEKF LLKRSSKANQ NGKFGFNSSQ VQFVKSSLRS FSPNGRIDNN

    1051  NKSKKEQHQR DPKVSHPIQM SISKLFQNLG FSEANNDNDT LSSSTSMKSN

    1101  STKKGASGLY LSNGSNNLYP TAATPRFRRY TEPLNMPLQS TFLDYSREYF

    1151  QEPQMRKQEA DEPGSVEYNA RLWRRNRNET IIQETQGEKK LSIYGNWSKR

    1201  FISLNNKSQP KLMKFTQFED QLVTADDRST ITVFDWEKGK TLSKFSNGTP

    1251  FGTKVTDLKF INEDDSALLL AGSSDGVIKI YRNYHDIDNF EIVSAWRGLT

    1301  DMLLTPRSTG LLTEWLQIRG SLLTTGDVKI IRVWDAHTET VEVDIPAKTS

    1351  SLITSLTADQ LAGNIFVAGF ADGSLRVYDR RLDPRDSMIR RWRAGNEKQG

    1401  VWINNVHLQR GGYRELVSGA TNGVVELWDI RSEDPVESFV DQNVVSQYGS

    1451  QQKPTTMTCM QVHEHAPIIA TGTKQIKIWT TSGDLLNSFK NSHTNGVTST

    1501  LAATGIPKSL SYSSTSDAFL SSMAFHPHRM MIAATNSHDS VVNIYKCEDE

    1551  RIDYF*

Protein Sequence for WashU_Sbay_Contig644.7:

WashU_Sbay_Contig644.7  Length: 1556  Mon Nov  7 15:38:51 2016  Type: P  Check: 550  ..

       1  MPEIYGPQPL KPLNTVMRHG FEEQYQSEQL LQSLANDFIF YFDDKRHRTN

      51  GNPIPDEDKQ KDVNRYYQPI TDWKIMKDRQ KTVSAALLLC LNLGVDPPDV

     101  MKTHPCARVE AWVDPLNFQD SKKAIEQIGK NLQAQYETLS LRTRYKQSLD

     151  PCVEDVKRFC NSLRRTSKED RILFHYNGHG VPKPTKSGEI WVFNRGYTQY

     201  IPVSLYDLQT WLGAPCIFVY DCNSAENILI NFQKFVQKRI KDDEDGNHDV

     251  AAPSPTPAYE DCFQLASCRS DELLLMSPEL PADLFSCCLT CPIEISIRIF

     301  LMQSPLKDSK YKVFFENATS NQSFADSRNS FKSKIPNVNI PGMLSDRRTP

     351  LGELNWIFTA ITDTIAWTSL PRPLFKKLFR HDLMIAALFR NFLLAKRIMP

     401  WYNCHPVSDP ELPDSITTHP MWKSWDLAMD EVLTKIVIDL KNAPPATALE

     451  SQMILQQQET LQNGGSSKPN LQDTKAGSMQ TQSRFAVANL STMSLVNNSA

     501  AQSRKSISLQ TSQQTQQQQQ QFTGFFEQNL TAFELWLKYA SNVRHPPEQL

     551  PIVLQVLLSQ VHRIRALVLL SRFLDLGPWA VYLSLSIGIF PYVLKLLQSP

     601  APELKPILVF IWARIMSIDY KNTQSELIKE KGYMYFITVL VPDWGVSGPS

     651  PTNGSAMMNG GNPLTMTASQ NINAPRSRYY DQQQANRTPN MGHSSLPFYH

     701  SNDTTDEQKA MAVFVLASFV RDFPLGQKNC FSLELVSKLC FYIENSEIPL

     751  LRQWCIILLG LLFADNPLNR FVCMNTGAVE ILLKSLKDPV SEVRTASIFA

     801  LKHFISGFQD SEAILRLQQE FEQQYQQLHS QLQHLQNQSH VQQQQQSQQQ

     851  QQHLEQQQMK IEKQIRHCQV MQNQLENIDL RKLKRQEIAD LISILPLIND

     901  GSPLVRKELI IYFSLIVNRY SNFFIVVVFN DLLEEIKQLE KSDINTRNAS

     951  DKYSVSHGSI FYTVWKSLLI LAEDPFLENK ELSKQVIDHI LLELSVHKEL

    1001  GGTFEVMEKF LLKRSSKANQ NGKFGFNSSQ VQFVKSSLRS FSPNGRIDNN

    1051  NKSKKEQHQR DPKVSHPIQM SISKLFQNLG FSEANNDNDT LSSSTSMKSN

    1101  STKKGASGLY LSNGSNNLYP TAATPRFRRY TEPLNMPLQS TFLDYSREYF

    1151  QEPQMRKQEA DEPGSVEYNA RLWRRNRNET IIQETQGEKK LSIYGNWSKR

    1201  FISLNNKSQP KLMKFTQFED QLVTADDRST ITVFDWEKGK TLSKFSNGTP

    1251  FGTKVTDLKF INEDDSALLL AGSSDGVIKI YRNYHDIDNF EIVSAWRGLT

    1301  DMLLTPRSTG LLTEWLQIRG SLLTTGDVKI IRVWDAHTET VEVDIPAKTS

    1351  SLITSLTADQ LAGNIFVAGF ADGSLRVYDR RLDPRDSMIR RWRAGNEKQG

    1401  VWINNVHLQR GGYRELVSGA TNGVVELWDI RSEDPVESFV DQNVVSQYGS

    1451  QQKPTTMTCM QVHEHAPIIA TGTKQIKIWT TSGDLLNSFK NSHTNGVTST

    1501  LAATGIPKSL SYSSTSDAFL SSMAFHPHRM MIAATNSHDS VVNIYKCEDE

    1551  RIDYF*

Protein Sequence for WashU_Scas_Contig684.14:

WashU_Scas_Contig684.14  Length: 1524  Mon Nov  7 15:38:51 2016  Type: P  Check: 6125  ..

       1  MPVTYGPQPL KPLNTQMRHG FEEQYDTQFI QSLVNNFIFY FDDKRHRTNG

      51  NPIPQAIKLQ DKDHYYQTIS DWKIMKDRQK TVSAALLLCL NLGVDPPDLV

     101  KTHPCARMES WVDPLNFQDS KKAIEQIGKN LQSQYETLSL RCRYKQSLDP

     151  CVEDVKRFCN SLRRSSKDDR ILFHYNGHGV PQPTPSGEIW VFNRGYTQYI

     201  PVSIYDLQSW LGAPCVYVYD CNSAGNIVTN FQKFVQKRIK DDQEGNHDAA

     251  APSPTAAYLQ CFQLASCRAN ELLLMSPELP ADLFTCCLTC PIEISIRIFL

     301  MQSPLKHSKY KIFFESTSND SNTESFKANV PTVSIPGVLS DRRTPLGELN

     351  WIFTAVTDTI AWTSLPRPLF KKLFRHDLMI AALFRNFLLA KRIMPWYNCH

     401  PISDPELPDS IADHPMWKSW DLAMDEVLGK LVTELKNSPP TSDLEKQLIL

     451  QQNDVNSGIT QQSAKVQPGK QKIQPESIQT QSKFAVSNLS TISLVNHPAL

     501  QNQGKKVQNV VLPSNSQQSQ QQQQQQQQFT GFFEQNLTAF ELWLKYASNS

     551  RHPPEQLPIV LQVLLSQVHR IRALVLLSRF LDLGPWAVYL SLSIGIFPYV

     601  LKLLQSPAPE LKPILVFIWA RIMSIDYKNT QAELIKERGY IYFISILVPE

     651  WGYNLTPSRS TSFINGVPMT PTTPTTPSLP MGAQPPHAND TTDEQKAMAV

     701  FVLASFVRDY KPGQKLCFSL ELITKLSFYI DNSDIPLLRQ WCILLIGLLY

     751  IQNPLNKFMC MNNGTLETLL LTLKDPVPEV RTAVILTLKH FISDLDDADI

     801  IIRTQQEYEQ QISQIHAQLQ QLQNSPQQQQ HNVEQQQLKL EQQLNHIQLM

     851  ESQLENVELI KLKQQELSNL IATLALINDG SPLVRKEVII FFSQIVYRYT

     901  NFFLVVVFNE LTDEISQLEG KDMEQSKPNY GENRHSVSHG SVFSTVWKAL

     951  LILAEDPYLE NKKMAEQVVD YILLELSSQN ELGSVFGKIE HYLVKRSTQM

    1001  TGTTNLNFNA TQIQIGKNTL RQFNKNKETD SSLNNNTNNL NSNDPDRFVT

    1051  LSRLFKKLGF GEPTLESDSV RAKKPSNIHL LGAAYGTSYT VQTPFFLEHK

    1101  EQLPLPLESR FFDYSCEYFQ EPQMRKPESD EVGSLEYNSR LWRRNRNEKI

    1151  IEETQKQKKL SLYGNWNNKI AILDNKTQPK VLKFTQFEDY LVSADDRDNI

    1201  TVFDWENKTR LNRFSNSNPF GTKITDLKFL NEDDITLLLT ASSDGIIKVY

    1251  RNFQSKDDVQ EISACRALTD MLLAPRSSGL LTEWQQIRGS LLATGDVKII

    1301  RVWDAHTETV EVDIPAKTSS LITALTSDQL AGDIFTAGFA DGSLRVYDRR

    1351  MDSRDSMVRR WRAGNGVHGT WINNVHLQRG GYRELVSSTT NGVVQLWDIR

    1401  SQEPVQTFVD ENSHGNQKKD TTMTCMQVHE HAPIIATGTR QLKIWTTSGD

    1451  LIANFKNNRG VSGGMANTLA ASGIGSSLSY SGSSNSFLSS MTFHPHRMLL

    1501  ATNNSHDASI SVYKCQDKKV AEY*