Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YHR005C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_GPA1/YHR005C   1   MGCTVSTQTIGDESDPFLQNKRANDVIEQSLQLEKQRDKNEIKLLLLGAG   50
MIT_Smik_c320_9624   1   MGCTISTQTLDDESDPFLQNKRANDVIEQSLQLEKQRDKNEIKLLLLGAG   50
MIT_Spar_c37_10390   1   MGCTVSTQTIDDESDPFLQNKRANDVIEQSLQLEKQRDKSEIKLLLLGAG   50
MIT_Suva_c229_23224   1   MGCTVSTQVLDDESDPFLQNKRANDAIEQSLQLEKQRDKNEIKLLLLGAG   50
WashU_Sbay_Contig668.8   1   MGCTVSTQVLDDESDPFLQNKRANDAIEQSLQLEKQRDKNEIKLLLLGAG   50
WashU_Sklu_Contig2439.4   1   MGCTASTHDLEDENNPFLQSKKANDLIEQSLQLEKQKEKNEIKLLLLGAG   50
WashU_Skud_Contig2067.17   1   MGCTVSTQTLDDESDPFLQNKRANDVIEQSLQLEKQRDKNEIKLLLLGAG   50
WashU_Smik_Contig2163.3   1   MGCTISTQTLDDESDPFLQNKRANDVIEQSLQLEKQRDKNEIKLLLLGAG   50
Symbols






**** **: : **.:****.*:*** **********::*.**********



SGD_Scer_GPA1/YHR005C   51   ESGKSTVLKQLKLLHQGGFSHQERLQYAQVIWADAIQSMKILIIQARKLG   100
MIT_Smik_c320_9624   51   ESGKSTVLKQLKLLHQGGFSHQERLQYAQVIWADAIQSMKILIIQARKLG   100
MIT_Spar_c37_10390   51   ESGKSTVLKQLKLLHQGGFSHQERLQYAQVIWADAIQSMKILIIQARKLG   100
MIT_Suva_c229_23224   51   ESGKSTVLKQLKLLHQGGFSHQERLQYAQVIWADAIQSMKILIIQARKLG   100
WashU_Sbay_Contig668.8   51   ESGKSTVLKQLKLLHQGGFSHQERLQYAQVIWADAIQSMKILIIQARKLG   100
WashU_Sklu_Contig2439.4   51   ESGKSTVLKQLRLLHQGGFTYQERLQYSQIIWADTIQSMKILIIQARKLN   100
WashU_Skud_Contig2067.17   51   ESGKSTVLKQLRLLHQGGFSHQERLQYAQVIWADAIQSMKILIIQARKLG   100
WashU_Smik_Contig2163.3   51   ESGKSTVLKQLKLLHQGGFSHQERLQYAQVIWADAIQSMKILIIQARKLG   100
Symbols






***********:*******::******:*:****:**************.



SGD_Scer_GPA1/YHR005C   101   IQLDCDDPINNKDLFACKRILLKAKALDYINASVAGGSDFLNDYVLKYSE   150
MIT_Smik_c320_9624   101   IQLDCDDPINNKDLFACKRIILKAKALDYINASVAGGSEFLNDYVLKYSE   150
MIT_Spar_c37_10390   101   IQLDCDDPIKNKDLFACKRILLKAKALDYINASVAGGSEFLNDYVLKYSE   150
MIT_Suva_c229_23224   101   IQLDCDDPVNNKDLFACKRILLKAKALDYINASIAGGSEFLNDYVLKYSE   150
WashU_Sbay_Contig668.8   101   IQLDCDDPVNNKDLFACKRILLKAKALDYINASIAGGSEFLNDYVLKYSE   150
WashU_Sklu_Contig2439.4   101   IPLDCDDPSSNRHLFECKRLLLRAKALDCIDANVAGGSEFLNDYVLKYSE   150
WashU_Skud_Contig2067.17   101   IQLDCDDPIKNKELFACKRILLKAKALDYINASVAGGSEFLNDYVLKYSE   150
WashU_Smik_Contig2163.3   101   IQLDCDDPINNKDLFACKRIILKAKALDYINASVAGGSEFLNDYVLKYSE   150
Symbols






* ****** .*:.** ***::*:***** *:*.:****:***********



SGD_Scer_GPA1/YHR005C   151   RYETRRRVQSTGRAKAAFDEDGNISNVKSDTDRDAETVTQNEDADRNNSS   200
MIT_Smik_c320_9624   151   RYEIKRRVQSTGRAKAAFDEDRDISNNRSGVDNDADTVAQNGDCDKNNSS   200
MIT_Spar_c37_10390   151   RYETRRRVQSTGRAKAAFDEDGNIPNTRSDTNKDAEAVTQNEDDDRNNRS   200
MIT_Suva_c229_23224   151   RHETKRRVQSTGRAKAAFDEDGNIANKRSAVASGDDTVAGSDEDNKNSTS   200
WashU_Sbay_Contig668.8   151   RHETKRRVQSTGRAKAAFDEDGNIANKRSAVASGDDTVAGSDEDNKNSTS   200
WashU_Sklu_Contig2439.4   151   RSENKRKVQSTGKVEAFDDFQKVEMQEQD---------------------   179
WashU_Skud_Contig2067.17   151   RYETKRRVQSTGRAKAAFDENKNIPIKKGGTENNADTVPHNEEDDKNSTS   200
WashU_Smik_Contig2163.3   151   RYEIKRRVQSTGRAKAAFDEDRDISNNRSGVDNDADTVAQNGDYDKNNSS   200
Symbols






* * :*:*****:.:* * : :.



SGD_Scer_GPA1/YHR005C   201   RINLQDICKDLNQEGDDQ--MFVRKTSREIQGQNRRNLIHEDIAKAIKQL   248
MIT_Smik_c320_9624   201   RLDLQDICKDLNQEGDDQ--MFVKKTSRGIQGPNRRNFIHNDIAKAIKQL   248
MIT_Spar_c37_10390   201   RLNLQDICKDLNQEGDDQ--MFVRKTSREIQGQNRQNLIHEDIAKAIKQL   248
MIT_Suva_c229_23224   201   RLNLQDICKDLNQEGDER--MFVKKTTRESQVQNKGNLIHEDIAKAIKQL   248
WashU_Sbay_Contig668.8   201   RLNLQDICKDLNQEGDER--MFVKKTTRESQVQNKGNLIHEDIAKAIKQL   248
WashU_Sklu_Contig2439.4   180   -TNLQEISQGLNETGSESNGIFLKQQQQSQQQSPSKNYSNEQIAYAIKEL   228
WashU_Skud_Contig2067.17   201   RLNLEDICKDLNQEGDDR--MFVRKTSKENQVPSRQNFIHEDIAEAIKQL   248
WashU_Smik_Contig2163.3   201   RLDLQDICKDLNQEGDDQ--MFVKKTSREIQGPNRRNFIHNDIAKAIKQL   248
Symbols






:*::*.:.**: *.: :*::: : * * :::** ***:*



SGD_Scer_GPA1/YHR005C   249   WNNDKGIKQCFARSNEFQLEGSAAYYFDNIEKFASPNYVCTDEDILKGRI   298
MIT_Smik_c320_9624   249   WNNDKGIKQCFARSNEFQLEGSAAYYFDNIEKFASPNYICTDEDILKGRI   298
MIT_Spar_c37_10390   249   WNNDKGIKQCFARSNEFQLEGSAAYYFDNIEKFASPNYVCTDEDILKGRI   298
MIT_Suva_c229_23224   249   WSNDKGIKQCFARSNEFQLEGSAAYYFDNIEKFASPNYVCTDEDILKGRI   298
WashU_Sbay_Contig668.8   249   WSNDKGIKQCFARSNEFQLEGSAAYYFDNIEKFASPNYVCTDEDILKGRI   298
WashU_Sklu_Contig2439.4   229   WTLDHGIKQCFARSNEFQLEGSAAYYFDTIEKFAQPGYHLFRX-------   271
WashU_Skud_Contig2067.17   249   WNNDKGIKQCFARSNEFQLEGSAAYYFDNIEKFASPNYVCTDEDILKGRI   298
WashU_Smik_Contig2163.3   249   WNNDKGIKQCFARSNEFQLEGSAAYYFDNIEKFASPNYICTDEDILKGRI   298
Symbols






*. *:***********************.*****.*.*



SGD_Scer_GPA1/YHR005C   299   KTTGITETEFNIGSSKFKVLDAGGQRSERKKWIHCFEGITAVLFVLAMSE   348
MIT_Smik_c320_9624   299   KTTGITETEFNIGSSKFKVLDAGGQRSERKKWIHCFEGITAVLFVLAMSE   348
MIT_Spar_c37_10390   299   KTTGITETEFNIGSSKFKVLDAGGQRSERKKWIHCFEGITAVLFVLAMSE   348
MIT_Suva_c229_23224   299   KTTGITETEFNIGSSKFKVLDAGGQRSERKKWIHCFEGITAVLFVLAMSE   348
WashU_Sbay_Contig668.8   299   KTTGITETEFNIGSSKFKVLDAGGQRSERKKWIHCFEGITAVLFVLAMSE   348
WashU_Sklu_Contig2439.4   
   --------------------------------------------------   
WashU_Skud_Contig2067.17   299   KTTGITETEFNIGSSKFKVLDAGGQRSERKKWIHCFEGITAVLFVLAMSE   348
WashU_Smik_Contig2163.3   299   KTTGITETEFNIGSSKFKVLDAGGQRSERKKWIHCFEGITAVLFVLAMSE   348
Symbols










SGD_Scer_GPA1/YHR005C   349   YDQMLFEDERVNRMHESIMLFDTLLNSKWFKDTPFILFLNKIDLFEEKVK   398
MIT_Smik_c320_9624   349   YDQMLFEDERVNRMHESIMLFDTLLNSKWFKDTPFILFLNKIDLFEEKVK   398
MIT_Spar_c37_10390   349   YDQMLFEDERVNRMHESIMLFDTLLNSKWFKDTPFILFLNKIDLFEEKVK   398
MIT_Suva_c229_23224   349   YDQMLFEDERVNRMHESIMLFDTLLNSKWFKDTPFILFLNKIDLFEEKVK   398
WashU_Sbay_Contig668.8   349   YDQMLFEDERVNRMHESIMLFDTLLNSKWFKDTPFILFLNKIDLFEEKVK   398
WashU_Sklu_Contig2439.4   
   --------------------------------------------------   
WashU_Skud_Contig2067.17   349   YDQMLFEDERVNRMHESIMLFDTLLNSKWFKDTPFILFLNKIDLFDEKVK   398
WashU_Smik_Contig2163.3   349   YDQMLFEDERVNRMHESIMLFDTLLNSKWFKDTPFILFLNKIDLFEEKVK   398
Symbols










SGD_Scer_GPA1/YHR005C   399   SMPIRKYFPDYQGRVGDAEAGLKYFEKIFLSLNKTNKPIYVKRTCATDTQ   448
MIT_Smik_c320_9624   399   SMPIRKYFPDYQGRVGDAEAGLRYFEKIFLSLNKTNKPIYVKRTCATDTQ   448
MIT_Spar_c37_10390   399   SMPIRKYFPDYQGRVGDAEAGLRYFEKIFLSLNKTNKPIYVKRTCATDTQ   448
MIT_Suva_c229_23224   399   SMPIRKYFPDYQGRVGDAEAGLKYFEKIFLSLNKTNKPIYVKRTCATDTQ   448
WashU_Sbay_Contig668.8   399   SMPIRKYFPDYQGRVGDAEAGLKYFEKIFLSLNKTNKPIYVKRTCATDTQ   448
WashU_Sklu_Contig2439.4   
   --------------------------------------------------   
WashU_Skud_Contig2067.17   399   SMPIRKHFPDYQGRVGDAEAGMRYFEKIFLNLNKTNKPIYVKRTCATDTQ   448
WashU_Smik_Contig2163.3   399   SMPIRKYFPDYQGRVGDAEAGLRYFEKIFLSLNKTNKPIYVKRTCATDTQ   448
Symbols










SGD_Scer_GPA1/YHR005C   449   TMKFVLSAVTDLIIQQNLKKIGII   472
MIT_Smik_c320_9624   449   NMKFVLSAVTDLIIQQNLKKSGII   472
MIT_Spar_c37_10390   449   TMKFVLSAVTDLIIQQNLKKSGII   472
MIT_Suva_c229_23224   449   TMKFVLSAVTDLIIQQNLKKSGII   472
WashU_Sbay_Contig668.8   449   TMKFVLSAVTDLIIQQNLKKSGII   472
WashU_Sklu_Contig2439.4   
   ------------------------   
WashU_Skud_Contig2067.17   449   TMKFVLSAVTDLIIQQNLKKSGII   472
WashU_Smik_Contig2163.3   449   NMKFVLSAVTDLIIQQNLKKSGII   472
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_GPA1/YHR005C:

SGD_Scer_GPA1/YHR005C  Length: 473  Mon Nov  7 15:34:34 2016  Type: P  Check: 9481  ..

       1  MGCTVSTQTI GDESDPFLQN KRANDVIEQS LQLEKQRDKN EIKLLLLGAG

      51  ESGKSTVLKQ LKLLHQGGFS HQERLQYAQV IWADAIQSMK ILIIQARKLG

     101  IQLDCDDPIN NKDLFACKRI LLKAKALDYI NASVAGGSDF LNDYVLKYSE

     151  RYETRRRVQS TGRAKAAFDE DGNISNVKSD TDRDAETVTQ NEDADRNNSS

     201  RINLQDICKD LNQEGDDQMF VRKTSREIQG QNRRNLIHED IAKAIKQLWN

     251  NDKGIKQCFA RSNEFQLEGS AAYYFDNIEK FASPNYVCTD EDILKGRIKT

     301  TGITETEFNI GSSKFKVLDA GGQRSERKKW IHCFEGITAV LFVLAMSEYD

     351  QMLFEDERVN RMHESIMLFD TLLNSKWFKD TPFILFLNKI DLFEEKVKSM

     401  PIRKYFPDYQ GRVGDAEAGL KYFEKIFLSL NKTNKPIYVK RTCATDTQTM

     451  KFVLSAVTDL IIQQNLKKIG II*

Protein Sequence for MIT_Smik_c320_9624:

MIT_Smik_c320_9624  Length: 473  Mon Nov  7 15:34:34 2016  Type: P  Check: 7771  ..

       1  MGCTISTQTL DDESDPFLQN KRANDVIEQS LQLEKQRDKN EIKLLLLGAG

      51  ESGKSTVLKQ LKLLHQGGFS HQERLQYAQV IWADAIQSMK ILIIQARKLG

     101  IQLDCDDPIN NKDLFACKRI ILKAKALDYI NASVAGGSEF LNDYVLKYSE

     151  RYEIKRRVQS TGRAKAAFDE DRDISNNRSG VDNDADTVAQ NGDCDKNNSS

     201  RLDLQDICKD LNQEGDDQMF VKKTSRGIQG PNRRNFIHND IAKAIKQLWN

     251  NDKGIKQCFA RSNEFQLEGS AAYYFDNIEK FASPNYICTD EDILKGRIKT

     301  TGITETEFNI GSSKFKVLDA GGQRSERKKW IHCFEGITAV LFVLAMSEYD

     351  QMLFEDERVN RMHESIMLFD TLLNSKWFKD TPFILFLNKI DLFEEKVKSM

     401  PIRKYFPDYQ GRVGDAEAGL RYFEKIFLSL NKTNKPIYVK RTCATDTQNM

     451  KFVLSAVTDL IIQQNLKKSG II*

Protein Sequence for MIT_Spar_c37_10390:

MIT_Spar_c37_10390  Length: 473  Mon Nov  7 15:34:34 2016  Type: P  Check: 9673  ..

       1  MGCTVSTQTI DDESDPFLQN KRANDVIEQS LQLEKQRDKS EIKLLLLGAG

      51  ESGKSTVLKQ LKLLHQGGFS HQERLQYAQV IWADAIQSMK ILIIQARKLG

     101  IQLDCDDPIK NKDLFACKRI LLKAKALDYI NASVAGGSEF LNDYVLKYSE

     151  RYETRRRVQS TGRAKAAFDE DGNIPNTRSD TNKDAEAVTQ NEDDDRNNRS

     201  RLNLQDICKD LNQEGDDQMF VRKTSREIQG QNRQNLIHED IAKAIKQLWN

     251  NDKGIKQCFA RSNEFQLEGS AAYYFDNIEK FASPNYVCTD EDILKGRIKT

     301  TGITETEFNI GSSKFKVLDA GGQRSERKKW IHCFEGITAV LFVLAMSEYD

     351  QMLFEDERVN RMHESIMLFD TLLNSKWFKD TPFILFLNKI DLFEEKVKSM

     401  PIRKYFPDYQ GRVGDAEAGL RYFEKIFLSL NKTNKPIYVK RTCATDTQTM

     451  KFVLSAVTDL IIQQNLKKSG II*

Protein Sequence for MIT_Suva_c229_23224:

MIT_Suva_c229_23224  Length: 473  Mon Nov  7 15:34:34 2016  Type: P  Check: 8895  ..

       1  MGCTVSTQVL DDESDPFLQN KRANDAIEQS LQLEKQRDKN EIKLLLLGAG

      51  ESGKSTVLKQ LKLLHQGGFS HQERLQYAQV IWADAIQSMK ILIIQARKLG

     101  IQLDCDDPVN NKDLFACKRI LLKAKALDYI NASIAGGSEF LNDYVLKYSE

     151  RHETKRRVQS TGRAKAAFDE DGNIANKRSA VASGDDTVAG SDEDNKNSTS

     201  RLNLQDICKD LNQEGDERMF VKKTTRESQV QNKGNLIHED IAKAIKQLWS

     251  NDKGIKQCFA RSNEFQLEGS AAYYFDNIEK FASPNYVCTD EDILKGRIKT

     301  TGITETEFNI GSSKFKVLDA GGQRSERKKW IHCFEGITAV LFVLAMSEYD

     351  QMLFEDERVN RMHESIMLFD TLLNSKWFKD TPFILFLNKI DLFEEKVKSM

     401  PIRKYFPDYQ GRVGDAEAGL KYFEKIFLSL NKTNKPIYVK RTCATDTQTM

     451  KFVLSAVTDL IIQQNLKKSG II*

Protein Sequence for WashU_Sbay_Contig668.8:

WashU_Sbay_Contig668.8  Length: 473  Mon Nov  7 15:34:34 2016  Type: P  Check: 8895  ..

       1  MGCTVSTQVL DDESDPFLQN KRANDAIEQS LQLEKQRDKN EIKLLLLGAG

      51  ESGKSTVLKQ LKLLHQGGFS HQERLQYAQV IWADAIQSMK ILIIQARKLG

     101  IQLDCDDPVN NKDLFACKRI LLKAKALDYI NASIAGGSEF LNDYVLKYSE

     151  RHETKRRVQS TGRAKAAFDE DGNIANKRSA VASGDDTVAG SDEDNKNSTS

     201  RLNLQDICKD LNQEGDERMF VKKTTRESQV QNKGNLIHED IAKAIKQLWS

     251  NDKGIKQCFA RSNEFQLEGS AAYYFDNIEK FASPNYVCTD EDILKGRIKT

     301  TGITETEFNI GSSKFKVLDA GGQRSERKKW IHCFEGITAV LFVLAMSEYD

     351  QMLFEDERVN RMHESIMLFD TLLNSKWFKD TPFILFLNKI DLFEEKVKSM

     401  PIRKYFPDYQ GRVGDAEAGL KYFEKIFLSL NKTNKPIYVK RTCATDTQTM

     451  KFVLSAVTDL IIQQNLKKSG II*

Protein Sequence for WashU_Sklu_Contig2439.4:

WashU_Sklu_Contig2439.4  Length: 271  Mon Nov  7 15:34:34 2016  Type: P  Check: 4765  ..

       1  MGCTASTHDL EDENNPFLQS KKANDLIEQS LQLEKQKEKN EIKLLLLGAG

      51  ESGKSTVLKQ LRLLHQGGFT YQERLQYSQI IWADTIQSMK ILIIQARKLN

     101  IPLDCDDPSS NRHLFECKRL LLRAKALDCI DANVAGGSEF LNDYVLKYSE

     151  RSENKRKVQS TGKVEAFDDF QKVEMQEQDT NLQEISQGLN ETGSESNGIF

     201  LKQQQQSQQQ SPSKNYSNEQ IAYAIKELWT LDHGIKQCFA RSNEFQLEGS

     251  AAYYFDTIEK FAQPGYHLFR X

Protein Sequence for WashU_Skud_Contig2067.17:

WashU_Skud_Contig2067.17  Length: 473  Mon Nov  7 15:34:34 2016  Type: P  Check: 9000  ..

       1  MGCTVSTQTL DDESDPFLQN KRANDVIEQS LQLEKQRDKN EIKLLLLGAG

      51  ESGKSTVLKQ LRLLHQGGFS HQERLQYAQV IWADAIQSMK ILIIQARKLG

     101  IQLDCDDPIK NKELFACKRI LLKAKALDYI NASVAGGSEF LNDYVLKYSE

     151  RYETKRRVQS TGRAKAAFDE NKNIPIKKGG TENNADTVPH NEEDDKNSTS

     201  RLNLEDICKD LNQEGDDRMF VRKTSKENQV PSRQNFIHED IAEAIKQLWN

     251  NDKGIKQCFA RSNEFQLEGS AAYYFDNIEK FASPNYVCTD EDILKGRIKT

     301  TGITETEFNI GSSKFKVLDA GGQRSERKKW IHCFEGITAV LFVLAMSEYD

     351  QMLFEDERVN RMHESIMLFD TLLNSKWFKD TPFILFLNKI DLFDEKVKSM

     401  PIRKHFPDYQ GRVGDAEAGM RYFEKIFLNL NKTNKPIYVK RTCATDTQTM

     451  KFVLSAVTDL IIQQNLKKSG II*

Protein Sequence for WashU_Smik_Contig2163.3:

WashU_Smik_Contig2163.3  Length: 473  Mon Nov  7 15:34:34 2016  Type: P  Check: 8165  ..

       1  MGCTISTQTL DDESDPFLQN KRANDVIEQS LQLEKQRDKN EIKLLLLGAG

      51  ESGKSTVLKQ LKLLHQGGFS HQERLQYAQV IWADAIQSMK ILIIQARKLG

     101  IQLDCDDPIN NKDLFACKRI ILKAKALDYI NASVAGGSEF LNDYVLKYSE

     151  RYEIKRRVQS TGRAKAAFDE DRDISNNRSG VDNDADTVAQ NGDYDKNNSS

     201  RLDLQDICKD LNQEGDDQMF VKKTSREIQG PNRRNFIHND IAKAIKQLWN

     251  NDKGIKQCFA RSNEFQLEGS AAYYFDNIEK FASPNYICTD EDILKGRIKT

     301  TGITETEFNI GSSKFKVLDA GGQRSERKKW IHCFEGITAV LFVLAMSEYD

     351  QMLFEDERVN RMHESIMLFD TLLNSKWFKD TPFILFLNKI DLFEEKVKSM

     401  PIRKYFPDYQ GRVGDAEAGL RYFEKIFLSL NKTNKPIYVK RTCATDTQNM

     451  KFVLSAVTDL IIQQNLKKSG II*