Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YHL032C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_GUT1/YHL032C   1   -----------------------MFPSLFRLVVFSKRYIFRSSQRLYTSL   27
MIT_Smik_c322_9487   1   -----------------------MFSSLFCLVASSKRLIFQSRQRLYTTL   27
MIT_Spar_c38_10528   1   -----------------------MFPSFFRLVASSKRYIFRSSRRLCSDL   27
MIT_Suva_c633_10121   1   MWGNACTRTIYRFVSWQELYYCSMSSSLCRLVASSKRYILRTPQRLYTSL   50
WashU_Sbay_Contig602.13   1   MWGNACTRTIYRFVSWQELYYCSMSSSLCRLVASSKRYILRTPQRLYTSL   50
WashU_Scas_Contig622.6   1   ---------------MSHWLSFARTTSLLFRSKPIRINFTKSKNNRLLMT   35
WashU_Skud_Contig1834.4   1   -----------------------MFHSLCRVVAFSKRYIFRPPQRPYTSL   27
WashU_Smik_Contig2720.3   1   -----------------------MFSSLFCLVASSKRLIFQSRQRLYTTL   27
Symbols






*: : : :. ..



SGD_Scer_GUT1/YHL032C   28   KQEQSRMSKIMEDLRSDYVPLIASIDVGTTSSRCILFNRWGQDVSKHQIE   77
MIT_Smik_c322_9487   28   TQEQGRMSKIMEDLQSDYVPLIASIDVGTTSSRCILFNRWGQDVSKHQIE   77
MIT_Spar_c38_10528   28   TQEQSRMSKIMEDLHSNYVPLIASIDVGTTSSRCILFNRWGQDVSKHQIE   77
MIT_Suva_c633_10121   51   TQEQSRMSRIMEDLHSDYVPLIASVDVGTTSSRCILFNRWGQDVSKHQIE   100
WashU_Sbay_Contig602.13   51   TQEQSRMSRIMEDLHSDYVPLIASVDVGTTSSRCILFNRWGQDVSKHQIE   100
WashU_Scas_Contig622.6   36   LSKGTQEKIRTASNDGDYIPLIASIDVGTTSSRAILFNKMGQEIEKHQIE   85
WashU_Skud_Contig1834.4   28   TQEQGRLSKIMEDLHSDYVPLIASVDVGTTSSRCILFNRWGQDVSKHQIE   77
WashU_Smik_Contig2720.3   28   TQEQGRMSKIMEDLQSDYVPLIASIDVGTTSSRCILFNRWGQDVSKHQIE   77
Symbols






.: : . . .:*:*****:********.****: **::.*****



SGD_Scer_GUT1/YHL032C   78   YSTSASKGKIGVSGLRRPSTAPARETPNAGDIKTSGKPIFSAEGYAIQET   127
MIT_Smik_c322_9487   78   YSTSASKGKIGVSGLRRPSTAPARETPRGSAVKTNGKPIFSAEGYAIQET   127
MIT_Spar_c38_10528   78   YSTSASKGKIGVSGLRRPSTAPARETPKASDIKTNGKPIFSAEGYAIQET   127
MIT_Suva_c633_10121   101   YSTSASKGKIGVSGLRRPSTAPAREAPRPSDVKANSKPIFSAEGYAIQET   150
WashU_Sbay_Contig602.13   101   YSTSASKGKIGVSGLRRPSTAPAREAPRPSDVKANSKPIFSAEGYAIQET   150
WashU_Scas_Contig622.6   86   YSTSASKGKYSVLGKRRFSDESNETTEVPSNKPS---TIFSAEGVTIRQT   132
WashU_Skud_Contig1834.4   78   YSTSASKGKIGVSGLRRPSTAPARETPRTSDVQVNGQPIFSAEGYAIQET   127
WashU_Smik_Contig2720.3   78   YSTSASKGKIGVSGLRRPSTAPARETPRGSAVKTNGKPIFSAEGYAIQET   127
Symbols






********* .* * ** * . . : . .****** :*::*



SGD_Scer_GUT1/YHL032C   128   KFLKIEELDLDFHN----------EPTLKFPKPGWVECHPQKLLVNVVQC   167
MIT_Smik_c322_9487   128   KFLKIEELELDFHN----------EPTLKFPRPGWVECHPQKILMNVVQC   167
MIT_Spar_c38_10528   128   KFLKIEELDLDFHN----------EPTLKFPKPGWVECHPQKLLVNVIQC   167
MIT_Suva_c633_10121   151   KFLKIEELDLDFHN----------EPTLKFPKPGWVECHPQKILVNVVQC   190
WashU_Sbay_Contig602.13   151   KFLKIEELDLDFHN----------EPTLKFPKPGWVECHPQKILVNVVQC   190
WashU_Scas_Contig622.6   133   PNLEIEDLLLNQSASTTAAHLSMSGPTLEFPKPGWIQCNPMALLANVVQC   182
WashU_Skud_Contig1834.4   128   KFVKIEELDLDFHN----------EPTLKFPKPGWVECHPQKILMNVVQC   167
WashU_Smik_Contig2720.3   128   KFLKIEELELDFHN----------EPTLKFPRPGWVECHPQKILMNVVQC   167
Symbols






::**:* *: ***:**:***::*:* :* **:**



SGD_Scer_GUT1/YHL032C   168   LASSLLSLQTINSERVANGLPPYKVICMGIANMRETTILWSRRTGKPIVN   217
MIT_Smik_c322_9487   168   LASSLLSLQAINSERTANGLPPYKVTSMGVANMRETTILWSRRTGRPVVN   217
MIT_Spar_c38_10528   168   LASSLLSLETINSERVANKLPPYKVTCMGIANMRETTILWSRRSGKPIVN   217
MIT_Suva_c633_10121   191   LASSLISLQSINTERVANGLPPYKVTCMGVANMRETTILWSRRTGKPIVN   240
WashU_Sbay_Contig602.13   191   LASSLISLQSINTERVANGLPPYKVTCMGVANMRETTILWSRRTGKPIVN   240
WashU_Scas_Contig622.6   183   LGSTLVSLSDLNKDRIKKSFPPYKIGCIGITNMRETTLVWSKSTGLPIIN   232
WashU_Skud_Contig1834.4   168   LASSLISLQTINAERVANGLPPYKVTCMGVANMRETTILWSRRTGKPIVN   217
WashU_Smik_Contig2720.3   168   LASSLLSLQAINSERTANGLPPYKVTSMGVANMRETTILWSRRTGRPVVN   217
Symbols






*.*:*:**. :* :* : :****: .:*::******::**: :* *::*



SGD_Scer_GUT1/YHL032C   218   YGIVWNDTRTIKIVRDKWQNTSVDRQLQLRQKTGLPLLSTYFSCSKLRWF   267
MIT_Smik_c322_9487   218   YGIVWNDTRTIKIVREKWQNTSVDRQLQLRQKTGLPLLSTYFSCSKLRWF   267
MIT_Spar_c38_10528   218   YGIVWNDTRTIKIVRDKWQNTSVDRQLQLRQKTGLPLLSTYFSCSKLRWF   267
MIT_Suva_c633_10121   241   YGIVWNDTRTIQIVRDKWQNTCVERQLQLRQKTGLPLLSTYFSCSKLRWF   290
WashU_Sbay_Contig602.13   241   YGIVWNDTRTIQIVRDKWQNTCVERQLQLRQKTGLPLLSTYFSCSKLRWF   290
WashU_Scas_Contig622.6   233   YGIVWNDTRNLPLIRTLQETVSNETAKKITKKTGLPLFSTYFSCSKLKWL   282
WashU_Skud_Contig1834.4   218   YGIVWNDTRTIKIVRERWQNTSVERQLQLRQKTGLPLLSTYFSCSKLRWL   267
WashU_Smik_Contig2720.3   218   YGIVWNDTRTIKIVREKWQNTSVDRQLQLRQKTGLPLLSTYFSCSKLRWF   267
Symbols






*********.: ::* :... : :: :******:*********:*:



SGD_Scer_GUT1/YHL032C   268   LDNEPLCTKAYEENDLMFGTVDTWLIYQLTKQKAFVSDVTNASRTGFMNL   317
MIT_Smik_c322_9487   268   LDNEPLCAKAYEEKDLMFGTVDTWLLYQLTKQKAFVSDVTNASRTGFMNL   317
MIT_Spar_c38_10528   268   LDNEPLCTKAYEENDLMFGTVDTWLIYQLTKQKAFVSDVTNASRTGFMNL   317
MIT_Suva_c633_10121   291   LDNEPLCAKAYEENDLMFGTVDTWLLYQLTKQKAFVSDVTNASRTGFMNL   340
WashU_Sbay_Contig602.13   291   LDNEPLCAKAYEENDLMFGTVDTWLLYQLTKQKAFVSDVTNASRTGFMNL   340
WashU_Scas_Contig622.6   283   LENEPLVQKAYQEKDLMFGTVDTWLLYNLTVEKAFVSDITNASRTGFMDL   332
WashU_Skud_Contig1834.4   268   LDNEPLCANAYEENDLMFGTVDTWLLYQLTKQKAFVSDVTNASRTGFMNL   317
WashU_Smik_Contig2720.3   268   LDNEPLCAKAYEEKDLMFGTVDTWLLYQLTKQKAFVSDVTNASRTGFMNL   317
Symbols






*:**** :**:*:***********:*:** :******:*********:*



SGD_Scer_GUT1/YHL032C   318   STLKYDNELLEFWGIDKNLIHMPEIVSSSQYYGDFGIPDWIMEKLHDSPK   367
MIT_Smik_c322_9487   318   STLKYDEELLAFWGIDGSLIHMPEIVSSSQYYGDFDIPGWIMDKLHDLPK   367
MIT_Spar_c38_10528   318   STLKYDSELLEFWGIDGNLIHMPEIVSSSQYYGDFGIPDWIMDKLHDLPK   367
MIT_Suva_c633_10121   341   STLQYDDELLKFWGIDRSLIHMPEIVSSSQYYGDFAIPDWIMDKLHDLPR   390
WashU_Sbay_Contig602.13   341   STLQYDDELLKFWGIDRSLIHMPEIVSSSQYYGDFAIPDWIMDKLHDLPR   390
WashU_Scas_Contig622.6   333   NSLDYDDELLSFWRIDPKLVHLPKIVSCSEYYGQLTIPEFTKNLLSTEIW   382
WashU_Skud_Contig1834.4   318   STLQYDEELLRFWDIDSNLIHLPEIVPSSQYYGDFGIPDWIMEKLHDLPK   367
WashU_Smik_Contig2720.3   318   STLKYDEELLAFWGIDGSLIHMPEIVSSSQYYGDFDIPGWIMDKLHDLPK   367
Symbols






.:*.**.*** ** ** .*:*:*:**..*:***:: ** : : *



SGD_Scer_GUT1/YHL032C   368   TVLRDLVKRNLPIQGCLGDQSASMVGQLAYKPGAAKCTYGTGCFLLYNTG   417
MIT_Smik_c322_9487   368   TVLQDLVESKLPIQGCLGDQSASMVGQLAYKPGAAKCTYGTGCFLLYNTG   417
MIT_Spar_c38_10528   368   TALRDLVKSNLPIQGCLGDQSASMVGQLAYKPGAAKCTYGTGCFLLYNTG   417
MIT_Suva_c633_10121   391   TLLQDLVDSNLPIQGCLGDQSASMVGQLAYKPGAAKCTYGTGCFLLYNTG   440
WashU_Sbay_Contig602.13   391   TLLQDLVDSNLPIQGCLGDQSASMVGQLAYKPGAAKCTYGTGCFLLYNTG   440
WashU_Scas_Contig622.6   383   EELNRFKNSRVPIQGCIGDQSASLVGQLAFKTGSAKCTYGTGCFLLYNTG   432
WashU_Skud_Contig1834.4   368   AVLQDLVESNLPIQGCLGDQSASMVGQLAYKPGAAKCTYGTGCFLLYNTG   417
WashU_Smik_Contig2720.3   368   TVLQDLVESKLPIQGCLGDQSASMVGQLAYKPGAAKCTYGTGCFLLYNTG   417
Symbols






*. : . .:*****:******:*****:*.*:****************



SGD_Scer_GUT1/YHL032C   418   TKKLISQHGALTTLAFWFPHLQEYGGQKPELSKPHFALEGSVAVAGAVVQ   467
MIT_Smik_c322_9487   418   TKKLISQHGALTTLAFWFPNLQEHDGQKPELNKPHFALEGSVAVAGAVVQ   467
MIT_Spar_c38_10528   418   TKKLISQHGALTTLAFWFPYLQEYGGQKPELSKPHFALEGSVAVAGAVVQ   467
MIT_Suva_c633_10121   441   TKKLISQHGALTTLAFWFPNLQEHDGQKPELSEPHFALEGSVAVAGAVVQ   490
WashU_Sbay_Contig602.13   441   TKKLISQHGALTTLAFWFPNLQEHDGQKPELSEPHFALEGSVAVAGAVVQ   490
WashU_Scas_Contig622.6   433   TEKMISEHGALTTPAYWFPNSTEQ-------PEPHFALEGSIAVGGSVVQ   475
WashU_Skud_Contig1834.4   418   TKKLISQHGALTTLAFWFPNLQEHDGKKPELSEPHFALEGSVAVAGAVVQ   467
WashU_Smik_Contig2720.3   418   TKKLISQHGALTTLAFWFPNLQEHDGQKPELNKPHFALEGSVAVAGAVVQ   467
Symbols






*:*:**:****** *:*** * :********:**.*:***



SGD_Scer_GUT1/YHL032C   468   WLRDNLRLIDKSEDVGPIASTVPDSGGVVFVPAFSGLFAPYWDPDARATI   517
MIT_Smik_c322_9487   468   WLRDNLRLIDKSEDVGPIASTVPDSGGVVFVPAFSGLFAPYWDPDARATI   517
MIT_Spar_c38_10528   468   WLRDNLRLIDKSEDVGPIASTVPDSGGVVFVPAFSGLFAPYWDPDARATI   517
MIT_Suva_c633_10121   491   WLRDNLRLIDKSEDVGPIASTVPDSGGVVFVPAFSGLFAPYWDPDARATI   540
WashU_Sbay_Contig602.13   491   WLRDNLRLIDKSEDVGPIASTVPDSGGVVFVPAFSGLFAPYWDPDARATI   540
WashU_Scas_Contig622.6   476   WLRDNLRLIPKSEHIGPLASRVRDSGGVVFVPAFNGLFAPYWDPDTRATI   525
WashU_Skud_Contig1834.4   468   WLRDNLRLINKSEDVGPIASTVPDSGGVVFVPAFSGLFAPYWDPDARATI   517
WashU_Smik_Contig2720.3   468   WLRDNLRLIDKSEDVGPIASTVPDSGGVVFVPAFSGLFAPYWDPDARATI   517
Symbols






********* ***.:**:** * ***********.**********:****



SGD_Scer_GUT1/YHL032C   518   MGMSQFTTASHIARAAVEGVCFQARAILKAMSSDAFGEGSKDRDFLEEIS   567
MIT_Smik_c322_9487   518   MGMSQFTTASHIARAAVEGVCFQARAILKAMSSDAFGEGSKDVDFLEEIS   567
MIT_Spar_c38_10528   518   MGMSQFTTASHIARAAVEGVCFQARAILKAMSSDAFGEGSKDRDFLEEIS   567
MIT_Suva_c633_10121   541   MGMSQFTTASHIARAAVEGVCFQARAILRAMSSDAFGEGSKDRDFLEEIS   590
WashU_Sbay_Contig602.13   541   MGMSQFTTASHIARAAVEGVCFQARAILRAMSSDAFGEGSKDRDFLEEIS   590
WashU_Scas_Contig622.6   526   MGISQSTTASHIARAAIEGVCFQVRAILKAMGSDEVYG------------   563
WashU_Skud_Contig1834.4   518   MGMSQFTTASHIARAAVEGVCFQARAILKAMSSDAFGEGSKDRDFLEEIS   567
WashU_Smik_Contig2720.3   518   MGMSQFTTASHIARAAVEGVCFQARAILKAMSSDAFGEGSKDVDFLEEIS   567
Symbols






**:** **********:******.****:**.** .



SGD_Scer_GUT1/YHL032C   568   DVTYEKSPLSVLAVDGGMSRSNEVMQIQADILGPCVKVRRSPTAECTALG   617
MIT_Smik_c322_9487   568   GVTYEKSPLSVLAVDGGMSRSNEVMQIQADILGPCVKVRRSPTAECTALG   617
MIT_Spar_c38_10528   568   DVTYEKSPLSVLAVDGGMSRSNEVMQIQADILGPCVKVRRSPTAECTALG   617
MIT_Suva_c633_10121   591   DVTYEKTPLSVLAVDGGMSRSNEVMQIQADILGPCVKVRRSPTAECTALG   640
WashU_Sbay_Contig602.13   591   DVTYEKTPLSVLAVDGGMSRSNEVMQIQADILGPCVKVRRSPTAECTALG   640
WashU_Scas_Contig622.6   564   DSAYEKKNLATLAVDGGMSKSNEVMQIQADILGPCIKLRRSPIVECTALG   613
WashU_Skud_Contig1834.4   568   DVTYEKSPLSVLAVDGGMSRSNEVMQIQADILGPCVKVRRSPTAECTALG   617
WashU_Smik_Contig2720.3   568   GVTYEKSPLSVLAVDGGMSRSNEVMQIQADILGPCVKVRRSPTAECTALG   617
Symbols






. :***. *:.********:***************:*:**** .******



SGD_Scer_GUT1/YHL032C   618   AAIAANMAFKDVNERPLWKDLHDVKKWVFYNGMEKNEQISPEAHPNLKIF   667
MIT_Smik_c322_9487   618   AAIAANMAFKDSKSRPLWKDLHDVKKWVFYNGIEKNEQISLEAHPNLKIF   667
MIT_Spar_c38_10528   618   AAIAANMAFKDSKVRPLWKDLHDVKKWVFYNGIEKNEQISSEAHPNLKIF   667
MIT_Suva_c633_10121   641   AAIAANMAFKDPKSRPLWKDLHDVKKWVFYNGIEKNEQISAEAHPNLRIF   690
WashU_Sbay_Contig602.13   641   AAIAANMAFKDPKSRPLWKDLHDVKKWVFYNGIEKNEQISAEAHPNLRIF   690
WashU_Scas_Contig622.6   614   AAIAANMAYKKEAERILWKDLNDVKKWIMYNGYDKDEGMPTIMHDNLAVF   663
WashU_Skud_Contig1834.4   618   AAIAANMAFKDPKSRPLWKDLHDVKKWVFYNGIEKNEQISPEVHPSLRIF   667
WashU_Smik_Contig2720.3   618   AAIAANMAFKDSKSRPLWKDLHDVKKWVFYNGIEKNEQISLEAHPNLKIF   667
Symbols






********:*. * *****:*****::*** :*:* :. * .* :*



SGD_Scer_GUT1/YHL032C   668   RSESDDAERRKHWKYWEVAVERSKGWLKDIEGEHEQVLENFQ-   709
MIT_Smik_c322_9487   668   RSQSDDSERRKHWKYWEVAVERSKGWLKDIEGEHEQVLENF--   708
MIT_Spar_c38_10528   668   RSQSDDSERRKHWKYWEVAVERSKGWLKDIEGEHEQVLENLQ-   709
MIT_Suva_c633_10121   691   ASQSDDAERRKHWKYWEVAVERSKGWLKDIEGEHDQVLESIK-   732
WashU_Sbay_Contig602.13   691   ASQSDDAERRKHWKYWEVAVERSKGWLKDIEGEHDQVLESIK-   732
WashU_Scas_Contig622.6   664   KSSIDDAERRKHWKLWQVAVKRSRGWLTDVDGEHEDVLEP---   703
WashU_Skud_Contig1834.4   668   RSQSDDAERRKHWKYWEVAVERSKGWLKDIEGEHDHVIENIQR   710
WashU_Smik_Contig2720.3   668   RSQSDDSERRKHWKYWEVAVERSKGWLKDIEGEHEQVLENF--   708
Symbols






*. **:******* *:***:**:***.*::***:.*:*



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_GUT1/YHL032C:

SGD_Scer_GUT1/YHL032C  Length: 710  Mon Nov  7 15:34:07 2016  Type: P  Check: 6705  ..

       1  MFPSLFRLVV FSKRYIFRSS QRLYTSLKQE QSRMSKIMED LRSDYVPLIA

      51  SIDVGTTSSR CILFNRWGQD VSKHQIEYST SASKGKIGVS GLRRPSTAPA

     101  RETPNAGDIK TSGKPIFSAE GYAIQETKFL KIEELDLDFH NEPTLKFPKP

     151  GWVECHPQKL LVNVVQCLAS SLLSLQTINS ERVANGLPPY KVICMGIANM

     201  RETTILWSRR TGKPIVNYGI VWNDTRTIKI VRDKWQNTSV DRQLQLRQKT

     251  GLPLLSTYFS CSKLRWFLDN EPLCTKAYEE NDLMFGTVDT WLIYQLTKQK

     301  AFVSDVTNAS RTGFMNLSTL KYDNELLEFW GIDKNLIHMP EIVSSSQYYG

     351  DFGIPDWIME KLHDSPKTVL RDLVKRNLPI QGCLGDQSAS MVGQLAYKPG

     401  AAKCTYGTGC FLLYNTGTKK LISQHGALTT LAFWFPHLQE YGGQKPELSK

     451  PHFALEGSVA VAGAVVQWLR DNLRLIDKSE DVGPIASTVP DSGGVVFVPA

     501  FSGLFAPYWD PDARATIMGM SQFTTASHIA RAAVEGVCFQ ARAILKAMSS

     551  DAFGEGSKDR DFLEEISDVT YEKSPLSVLA VDGGMSRSNE VMQIQADILG

     601  PCVKVRRSPT AECTALGAAI AANMAFKDVN ERPLWKDLHD VKKWVFYNGM

     651  EKNEQISPEA HPNLKIFRSE SDDAERRKHW KYWEVAVERS KGWLKDIEGE

     701  HEQVLENFQ*

Protein Sequence for MIT_Smik_c322_9487:

MIT_Smik_c322_9487  Length: 709  Mon Nov  7 15:34:07 2016  Type: P  Check: 5516  ..

       1  MFSSLFCLVA SSKRLIFQSR QRLYTTLTQE QGRMSKIMED LQSDYVPLIA

      51  SIDVGTTSSR CILFNRWGQD VSKHQIEYST SASKGKIGVS GLRRPSTAPA

     101  RETPRGSAVK TNGKPIFSAE GYAIQETKFL KIEELELDFH NEPTLKFPRP

     151  GWVECHPQKI LMNVVQCLAS SLLSLQAINS ERTANGLPPY KVTSMGVANM

     201  RETTILWSRR TGRPVVNYGI VWNDTRTIKI VREKWQNTSV DRQLQLRQKT

     251  GLPLLSTYFS CSKLRWFLDN EPLCAKAYEE KDLMFGTVDT WLLYQLTKQK

     301  AFVSDVTNAS RTGFMNLSTL KYDEELLAFW GIDGSLIHMP EIVSSSQYYG

     351  DFDIPGWIMD KLHDLPKTVL QDLVESKLPI QGCLGDQSAS MVGQLAYKPG

     401  AAKCTYGTGC FLLYNTGTKK LISQHGALTT LAFWFPNLQE HDGQKPELNK

     451  PHFALEGSVA VAGAVVQWLR DNLRLIDKSE DVGPIASTVP DSGGVVFVPA

     501  FSGLFAPYWD PDARATIMGM SQFTTASHIA RAAVEGVCFQ ARAILKAMSS

     551  DAFGEGSKDV DFLEEISGVT YEKSPLSVLA VDGGMSRSNE VMQIQADILG

     601  PCVKVRRSPT AECTALGAAI AANMAFKDSK SRPLWKDLHD VKKWVFYNGI

     651  EKNEQISLEA HPNLKIFRSQ SDDSERRKHW KYWEVAVERS KGWLKDIEGE

     701  HEQVLENF*

Protein Sequence for MIT_Spar_c38_10528:

MIT_Spar_c38_10528  Length: 710  Mon Nov  7 15:34:07 2016  Type: P  Check: 7171  ..

       1  MFPSFFRLVA SSKRYIFRSS RRLCSDLTQE QSRMSKIMED LHSNYVPLIA

      51  SIDVGTTSSR CILFNRWGQD VSKHQIEYST SASKGKIGVS GLRRPSTAPA

     101  RETPKASDIK TNGKPIFSAE GYAIQETKFL KIEELDLDFH NEPTLKFPKP

     151  GWVECHPQKL LVNVIQCLAS SLLSLETINS ERVANKLPPY KVTCMGIANM

     201  RETTILWSRR SGKPIVNYGI VWNDTRTIKI VRDKWQNTSV DRQLQLRQKT

     251  GLPLLSTYFS CSKLRWFLDN EPLCTKAYEE NDLMFGTVDT WLIYQLTKQK

     301  AFVSDVTNAS RTGFMNLSTL KYDSELLEFW GIDGNLIHMP EIVSSSQYYG

     351  DFGIPDWIMD KLHDLPKTAL RDLVKSNLPI QGCLGDQSAS MVGQLAYKPG

     401  AAKCTYGTGC FLLYNTGTKK LISQHGALTT LAFWFPYLQE YGGQKPELSK

     451  PHFALEGSVA VAGAVVQWLR DNLRLIDKSE DVGPIASTVP DSGGVVFVPA

     501  FSGLFAPYWD PDARATIMGM SQFTTASHIA RAAVEGVCFQ ARAILKAMSS

     551  DAFGEGSKDR DFLEEISDVT YEKSPLSVLA VDGGMSRSNE VMQIQADILG

     601  PCVKVRRSPT AECTALGAAI AANMAFKDSK VRPLWKDLHD VKKWVFYNGI

     651  EKNEQISSEA HPNLKIFRSQ SDDSERRKHW KYWEVAVERS KGWLKDIEGE

     701  HEQVLENLQ*

Protein Sequence for MIT_Suva_c633_10121:

MIT_Suva_c633_10121  Length: 733  Mon Nov  7 15:34:07 2016  Type: P  Check: 1536  ..

       1  MWGNACTRTI YRFVSWQELY YCSMSSSLCR LVASSKRYIL RTPQRLYTSL

      51  TQEQSRMSRI MEDLHSDYVP LIASVDVGTT SSRCILFNRW GQDVSKHQIE

     101  YSTSASKGKI GVSGLRRPST APAREAPRPS DVKANSKPIF SAEGYAIQET

     151  KFLKIEELDL DFHNEPTLKF PKPGWVECHP QKILVNVVQC LASSLISLQS

     201  INTERVANGL PPYKVTCMGV ANMRETTILW SRRTGKPIVN YGIVWNDTRT

     251  IQIVRDKWQN TCVERQLQLR QKTGLPLLST YFSCSKLRWF LDNEPLCAKA

     301  YEENDLMFGT VDTWLLYQLT KQKAFVSDVT NASRTGFMNL STLQYDDELL

     351  KFWGIDRSLI HMPEIVSSSQ YYGDFAIPDW IMDKLHDLPR TLLQDLVDSN

     401  LPIQGCLGDQ SASMVGQLAY KPGAAKCTYG TGCFLLYNTG TKKLISQHGA

     451  LTTLAFWFPN LQEHDGQKPE LSEPHFALEG SVAVAGAVVQ WLRDNLRLID

     501  KSEDVGPIAS TVPDSGGVVF VPAFSGLFAP YWDPDARATI MGMSQFTTAS

     551  HIARAAVEGV CFQARAILRA MSSDAFGEGS KDRDFLEEIS DVTYEKTPLS

     601  VLAVDGGMSR SNEVMQIQAD ILGPCVKVRR SPTAECTALG AAIAANMAFK

     651  DPKSRPLWKD LHDVKKWVFY NGIEKNEQIS AEAHPNLRIF ASQSDDAERR

     701  KHWKYWEVAV ERSKGWLKDI EGEHDQVLES IK*

Protein Sequence for WashU_Sbay_Contig602.13:

WashU_Sbay_Contig602.13  Length: 733  Mon Nov  7 15:34:07 2016  Type: P  Check: 1536  ..

       1  MWGNACTRTI YRFVSWQELY YCSMSSSLCR LVASSKRYIL RTPQRLYTSL

      51  TQEQSRMSRI MEDLHSDYVP LIASVDVGTT SSRCILFNRW GQDVSKHQIE

     101  YSTSASKGKI GVSGLRRPST APAREAPRPS DVKANSKPIF SAEGYAIQET

     151  KFLKIEELDL DFHNEPTLKF PKPGWVECHP QKILVNVVQC LASSLISLQS

     201  INTERVANGL PPYKVTCMGV ANMRETTILW SRRTGKPIVN YGIVWNDTRT

     251  IQIVRDKWQN TCVERQLQLR QKTGLPLLST YFSCSKLRWF LDNEPLCAKA

     301  YEENDLMFGT VDTWLLYQLT KQKAFVSDVT NASRTGFMNL STLQYDDELL

     351  KFWGIDRSLI HMPEIVSSSQ YYGDFAIPDW IMDKLHDLPR TLLQDLVDSN

     401  LPIQGCLGDQ SASMVGQLAY KPGAAKCTYG TGCFLLYNTG TKKLISQHGA

     451  LTTLAFWFPN LQEHDGQKPE LSEPHFALEG SVAVAGAVVQ WLRDNLRLID

     501  KSEDVGPIAS TVPDSGGVVF VPAFSGLFAP YWDPDARATI MGMSQFTTAS

     551  HIARAAVEGV CFQARAILRA MSSDAFGEGS KDRDFLEEIS DVTYEKTPLS

     601  VLAVDGGMSR SNEVMQIQAD ILGPCVKVRR SPTAECTALG AAIAANMAFK

     651  DPKSRPLWKD LHDVKKWVFY NGIEKNEQIS AEAHPNLRIF ASQSDDAERR

     701  KHWKYWEVAV ERSKGWLKDI EGEHDQVLES IK*

Protein Sequence for WashU_Scas_Contig622.6:

WashU_Scas_Contig622.6  Length: 704  Mon Nov  7 15:34:07 2016  Type: P  Check: 1232  ..

       1  MSHWLSFART TSLLFRSKPI RINFTKSKNN RLLMTLSKGT QEKIRTASND

      51  GDYIPLIASI DVGTTSSRAI LFNKMGQEIE KHQIEYSTSA SKGKYSVLGK

     101  RRFSDESNET TEVPSNKPST IFSAEGVTIR QTPNLEIEDL LLNQSASTTA

     151  AHLSMSGPTL EFPKPGWIQC NPMALLANVV QCLGSTLVSL SDLNKDRIKK

     201  SFPPYKIGCI GITNMRETTL VWSKSTGLPI INYGIVWNDT RNLPLIRTLQ

     251  ETVSNETAKK ITKKTGLPLF STYFSCSKLK WLLENEPLVQ KAYQEKDLMF

     301  GTVDTWLLYN LTVEKAFVSD ITNASRTGFM DLNSLDYDDE LLSFWRIDPK

     351  LVHLPKIVSC SEYYGQLTIP EFTKNLLSTE IWEELNRFKN SRVPIQGCIG

     401  DQSASLVGQL AFKTGSAKCT YGTGCFLLYN TGTEKMISEH GALTTPAYWF

     451  PNSTEQPEPH FALEGSIAVG GSVVQWLRDN LRLIPKSEHI GPLASRVRDS

     501  GGVVFVPAFN GLFAPYWDPD TRATIMGISQ STTASHIARA AIEGVCFQVR

     551  AILKAMGSDE VYGDSAYEKK NLATLAVDGG MSKSNEVMQI QADILGPCIK

     601  LRRSPIVECT ALGAAIAANM AYKKEAERIL WKDLNDVKKW IMYNGYDKDE

     651  GMPTIMHDNL AVFKSSIDDA ERRKHWKLWQ VAVKRSRGWL TDVDGEHEDV

     701  LEP*

Protein Sequence for WashU_Skud_Contig1834.4:

WashU_Skud_Contig1834.4  Length: 711  Mon Nov  7 15:34:07 2016  Type: P  Check: 1442  ..

       1  MFHSLCRVVA FSKRYIFRPP QRPYTSLTQE QGRLSKIMED LHSDYVPLIA

      51  SVDVGTTSSR CILFNRWGQD VSKHQIEYST SASKGKIGVS GLRRPSTAPA

     101  RETPRTSDVQ VNGQPIFSAE GYAIQETKFV KIEELDLDFH NEPTLKFPKP

     151  GWVECHPQKI LMNVVQCLAS SLISLQTINA ERVANGLPPY KVTCMGVANM

     201  RETTILWSRR TGKPIVNYGI VWNDTRTIKI VRERWQNTSV ERQLQLRQKT

     251  GLPLLSTYFS CSKLRWLLDN EPLCANAYEE NDLMFGTVDT WLLYQLTKQK

     301  AFVSDVTNAS RTGFMNLSTL QYDEELLRFW DIDSNLIHLP EIVPSSQYYG

     351  DFGIPDWIME KLHDLPKAVL QDLVESNLPI QGCLGDQSAS MVGQLAYKPG

     401  AAKCTYGTGC FLLYNTGTKK LISQHGALTT LAFWFPNLQE HDGKKPELSE

     451  PHFALEGSVA VAGAVVQWLR DNLRLINKSE DVGPIASTVP DSGGVVFVPA

     501  FSGLFAPYWD PDARATIMGM SQFTTASHIA RAAVEGVCFQ ARAILKAMSS

     551  DAFGEGSKDR DFLEEISDVT YEKSPLSVLA VDGGMSRSNE VMQIQADILG

     601  PCVKVRRSPT AECTALGAAI AANMAFKDPK SRPLWKDLHD VKKWVFYNGI

     651  EKNEQISPEV HPSLRIFRSQ SDDAERRKHW KYWEVAVERS KGWLKDIEGE

     701  HDHVIENIQR *

Protein Sequence for WashU_Smik_Contig2720.3:

WashU_Smik_Contig2720.3  Length: 709  Mon Nov  7 15:34:07 2016  Type: P  Check: 5516  ..

       1  MFSSLFCLVA SSKRLIFQSR QRLYTTLTQE QGRMSKIMED LQSDYVPLIA

      51  SIDVGTTSSR CILFNRWGQD VSKHQIEYST SASKGKIGVS GLRRPSTAPA

     101  RETPRGSAVK TNGKPIFSAE GYAIQETKFL KIEELELDFH NEPTLKFPRP

     151  GWVECHPQKI LMNVVQCLAS SLLSLQAINS ERTANGLPPY KVTSMGVANM

     201  RETTILWSRR TGRPVVNYGI VWNDTRTIKI VREKWQNTSV DRQLQLRQKT

     251  GLPLLSTYFS CSKLRWFLDN EPLCAKAYEE KDLMFGTVDT WLLYQLTKQK

     301  AFVSDVTNAS RTGFMNLSTL KYDEELLAFW GIDGSLIHMP EIVSSSQYYG

     351  DFDIPGWIMD KLHDLPKTVL QDLVESKLPI QGCLGDQSAS MVGQLAYKPG

     401  AAKCTYGTGC FLLYNTGTKK LISQHGALTT LAFWFPNLQE HDGQKPELNK

     451  PHFALEGSVA VAGAVVQWLR DNLRLIDKSE DVGPIASTVP DSGGVVFVPA

     501  FSGLFAPYWD PDARATIMGM SQFTTASHIA RAAVEGVCFQ ARAILKAMSS

     551  DAFGEGSKDV DFLEEISGVT YEKSPLSVLA VDGGMSRSNE VMQIQADILG

     601  PCVKVRRSPT AECTALGAAI AANMAFKDSK SRPLWKDLHD VKKWVFYNGI

     651  EKNEQISLEA HPNLKIFRSQ SDDSERRKHW KYWEVAVERS KGWLKDIEGE

     701  HEQVLENF*