Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YGR151C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_YGR151C   1   MKWKVLQLKTQEIKVNNLAKSSLHQPGSLVLRNRIRNNQTISNHQKVYIT   50
MIT_Smik_c542_8819   1   MRWKVWPSRMQETKVNSLTKMSLHQPSSLILPSKIQNIQTS-KHLKGCTT   49
Symbols






*:*** : ** ***.*:* *****.**:* .:*:* ** :* * *



SGD_Scer_YGR151C   51   NLHKDKLKLNNLLRLMKSTNRHMPFRNLVLATGQELALLHNKRKRRKTLP   100
MIT_Smik_c542_8819   50   SHHKDK--------------------------------------------   55
Symbols






. ****



SGD_Scer_YGR151C   101   LALFYSHLILL   111
MIT_Smik_c542_8819   
   -----------   
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_YGR151C:

SGD_Scer_YGR151C  Length: 112  Mon Nov  7 15:30:13 2016  Type: P  Check: 4745  ..

       1  MKWKVLQLKT QEIKVNNLAK SSLHQPGSLV LRNRIRNNQT ISNHQKVYIT

      51  NLHKDKLKLN NLLRLMKSTN RHMPFRNLVL ATGQELALLH NKRKRRKTLP

     101  LALFYSHLIL L*

Protein Sequence for MIT_Smik_c542_8819:

MIT_Smik_c542_8819  Length: 56  Mon Nov  7 15:30:13 2016  Type: P  Check: 1219  ..

       1  MRWKVWPSRM QETKVNSLTK MSLHQPSSLI LPSKIQNIQT SKHLKGCTTS

      51  HHKDK*