Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YGR135W and Homologs


Choose two or more sequences for alignment:
Pick a sequence type:
Best Hits & Orthologs"Other" Hits

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_PRE9/YGR135W   1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAER   50
MIT_Smik_c539_8748   1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAER   50
MIT_Suva_c349_9064   1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAER   50
WashU_Sbay_Contig495.10   1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAER   50
WashU_Scas_Contig712.57   1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAER   50
WashU_Sklu_Contig1600.4   1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAER   50
WashU_Smik_Contig1923.3   1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAER   50
Symbols






****************************************.**:******



SGD_Scer_PRE9/YGR135W   51   KVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLK   100
MIT_Smik_c539_8748   51   KVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLK   100
MIT_Suva_c349_9064   51   KVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLK   100
WashU_Sbay_Contig495.10   51   KVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLK   100
WashU_Scas_Contig712.57   51   KVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLK   100
WashU_Sklu_Contig1600.4   51   KVTSKLLEQDTSSEKLYKLNDNITVAVAGLTADAEILINTARVYAQNYLQ   100
WashU_Smik_Contig1923.3   51   KVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLK   100
Symbols






****.*******:********:*:******************::**.**:



SGD_Scer_PRE9/YGR135W   101   TYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYT   150
MIT_Smik_c539_8748   101   TYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYT   150
MIT_Suva_c349_9064   101   SYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGHDDRYGYQLYT   150
WashU_Sbay_Contig495.10   101   SYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGHDDRYGYQLYT   150
WashU_Scas_Contig712.57   101   TYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYT   150
WashU_Sklu_Contig1600.4   101   TYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLYT   150
WashU_Smik_Contig1923.3   101   TYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYT   150
Symbols






:***:**********************************:*:********



SGD_Scer_PRE9/YGR135W   151   SNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIELALKTLSKT   200
MIT_Smik_c539_8748   151   SNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKT   200
MIT_Suva_c349_9064   151   SNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKT   200
WashU_Sbay_Contig495.10   151   SNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKT   200
WashU_Scas_Contig712.57   151   SNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELALKTLSKT   200
WashU_Sklu_Contig1600.4   151   SNPSGNYSGWKAISVGANTSAAQTLLQMDYKDGINLDGAIELALKTLSKT   200
WashU_Smik_Contig1923.3   151   SNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKT   200
Symbols






*******:************************.:::*.**:*********



SGD_Scer_PRE9/YGR135W   201   TDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGITKKDED   250
MIT_Smik_c539_8748   201   TDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLVKTGIIKKDED   250
MIT_Suva_c349_9064   201   TDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDLLVKTGITKKDED   250
WashU_Sbay_Contig495.10   201   TDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDLLVKTGITKKDED   250
WashU_Scas_Contig712.57   201   TDSSSLTYDKLELATIKKGTTTDEVYQKIYKPEELKELLLKTGITKKSED   250
WashU_Sklu_Contig1600.4   201   TDSSALTHDRIEFATIKKGSN-GQLYQKIYKPQEIQTLLSKTGITKKDDE   249
WashU_Smik_Contig1923.3   201   TDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLVKTGITKKDED   250
Symbols






****:**:*::*:***:** . .::****:**:*:: :* **** **.::



SGD_Scer_PRE9/YGR135W   251   EEADEDMK-   258
MIT_Smik_c539_8748   251   EEADEEMK-   258
MIT_Suva_c349_9064   251   EEADEEMK-   258
WashU_Sbay_Contig495.10   251   EEADEEMK-   258
WashU_Scas_Contig712.57   251   EDDEDEEMK   259
WashU_Sklu_Contig1600.4   250   DES------   252
WashU_Smik_Contig1923.3   251   EEADEEMK-   258
Symbols






::



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_PRE9/YGR135W:

SGD_Scer_PRE9/YGR135W  Length: 259  Mon Nov  7 15:29:54 2016  Type: P  Check: 860  ..

       1  MGSRRYDSRT TIFSPEGRLY QVEYALESIS HAGTAIGIMA SDGIVLAAER

      51  KVTSTLLEQD TSTEKLYKLN DKIAVAVAGL TADAEILINT ARIHAQNYLK

     101  TYNEDIPVEI LVRRLSDIKQ GYTQHGGLRP FGVSFIYAGY DDRYGYQLYT

     151  SNPSGNYTGW KAISVGANTS AAQTLLQMDY KDDMKVDDAI ELALKTLSKT

     201  TDSSALTYDR LEFATIRKGA NDGEVYQKIF KPQEIKDILV KTGITKKDED

     251  EEADEDMK*

Protein Sequence for MIT_Smik_c539_8748:

MIT_Smik_c539_8748  Length: 259  Mon Nov  7 15:29:54 2016  Type: P  Check: 2046  ..

       1  MGSRRYDSRT TIFSPEGRLY QVEYALESIS HAGTAIGIMA SDGIVLAAER

      51  KVTSTLLEQD TSTEKLYKLN DKISVAVAGL TADAEILINT ARIHAQNYLK

     101  TYNEDIPVEI LVRRLSDIKQ GYTQHGGLRP FGVSFIYAGY DDRYGYQLYT

     151  SNPSGNYTGW KAISVGANTS AAQTLLQMDY KDDMKVDDAI DLALKTLSKT

     201  TDSSALTYDR LEFATIRKGV NDGEVYQKIF KPQEIKDLLV KTGIIKKDED

     251  EEADEEMK*

Protein Sequence for MIT_Suva_c349_9064:

MIT_Suva_c349_9064  Length: 259  Mon Nov  7 15:29:54 2016  Type: P  Check: 880  ..

       1  MGSRRYDSRT TIFSPEGRLY QVEYALESIS HAGTAIGIMA SDGIVLAAER

      51  KVTSTLLEQD TSTEKLYKLN DKIAVAVAGL TADAEILINT ARVHAQNYLK

     101  SYNEDIPVEI LVRRLSDIKQ GYTQHGGLRP FGVSFIYAGH DDRYGYQLYT

     151  SNPSGNYTGW KAISVGANTS AAQTLLQMDY KDDMKVDDAI DLALKTLSKT

     201  TDSSALTYDR LEFATIRKGA NDGEVYQKIF KPQEIKDLLV KTGITKKDED

     251  EEADEEMK*

Protein Sequence for WashU_Sbay_Contig495.10:

WashU_Sbay_Contig495.10  Length: 259  Mon Nov  7 15:29:54 2016  Type: P  Check: 880  ..

       1  MGSRRYDSRT TIFSPEGRLY QVEYALESIS HAGTAIGIMA SDGIVLAAER

      51  KVTSTLLEQD TSTEKLYKLN DKIAVAVAGL TADAEILINT ARVHAQNYLK

     101  SYNEDIPVEI LVRRLSDIKQ GYTQHGGLRP FGVSFIYAGH DDRYGYQLYT

     151  SNPSGNYTGW KAISVGANTS AAQTLLQMDY KDDMKVDDAI DLALKTLSKT

     201  TDSSALTYDR LEFATIRKGA NDGEVYQKIF KPQEIKDLLV KTGITKKDED

     251  EEADEEMK*

Protein Sequence for WashU_Scas_Contig712.57:

WashU_Scas_Contig712.57  Length: 260  Mon Nov  7 15:29:54 2016  Type: P  Check: 6666  ..

       1  MGSRRYDSRT TIFSPEGRLY QVEYALESIS HAGTAIGIMA DDGLVLAAER

      51  KVTSTLLEQD TSTEKLYKLN DKITVAVAGL TADAEILINT ARVYAQSYLK

     101  TYNEEIPVEI LVRRLSDIKQ GYTQHGGLRP FGVSFIYAGY DDRYGYQLYT

     151  SNPSGNYTGW KAISVGANTS AAQTLLQMDY KDNMKLDDAI ELALKTLSKT

     201  TDSSSLTYDK LELATIKKGT TTDEVYQKIY KPEELKELLL KTGITKKSED

     251  EDDEDEEMK*

Protein Sequence for WashU_Sklu_Contig1600.4:

WashU_Sklu_Contig1600.4  Length: 253  Mon Nov  7 15:29:54 2016  Type: P  Check: 648  ..

       1  MGSRRYDSRT TIFSPEGRLY QVEYALESIS HAGTAIGIMA SDGIVLAAER

      51  KVTSKLLEQD TSSEKLYKLN DNITVAVAGL TADAEILINT ARVYAQNYLQ

     101  TYNEEIPVEI LVRRLSDIKQ GYTQHGGLRP FGVSFIYAGY DERYGYQLYT

     151  SNPSGNYSGW KAISVGANTS AAQTLLQMDY KDGINLDGAI ELALKTLSKT

     201  TDSSALTHDR IEFATIKKGS NGQLYQKIYK PQEIQTLLSK TGITKKDDED

     251  ES*

Protein Sequence for WashU_Smik_Contig1923.3:

WashU_Smik_Contig1923.3  Length: 259  Mon Nov  7 15:29:54 2016  Type: P  Check: 2233  ..

       1  MGSRRYDSRT TIFSPEGRLY QVEYALESIS HAGTAIGIMA SDGIVLAAER

      51  KVTSTLLEQD TSTEKLYKLN DKISVAVAGL TADAEILINT ARIHAQNYLK

     101  TYNEDIPVEI LVRRLSDIKQ GYTQHGGLRP FGVSFIYAGY DDRYGYQLYT

     151  SNPSGNYTGW KAISVGANTS AAQTLLQMDY KDDMKVDDAI DLALKTLSKT

     201  TDSSALTYDR LEFATIRKGV NDGEVYQKIF KPQEIKDLLV KTGITKKDED

     251  EEADEEMK*