Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YGR103W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_NOP7/YGR103W   1   MRIKKKNTRGNARNFITRSQAVRKLQVSLADFRRLCIFKGIYPREPRNKK   50
MIT_Smik_c527_8616   1   MRIKKKNTRGNARNFITRSQAVRKLQVSLADFRRLCIFKGIYPREPRNKK   50
MIT_Spar_c4_8024   1   MRIKKKNTRGNARNFITRSQAVRKLQVSLADFRRLCIFKGIYPREPRNKK   50
MIT_Suva_c351_9191   1   MRIKKKNTRGNARNFITRSQAVRKLQVSLADFRRLCIFKGIYPREPRNKK   50
WashU_Sbay_Contig642.35   1   MRIKKKNTRGNARNFITRSQAVRKLQVSLADFRRLCIFKGIYPREPRNKK   50
WashU_Scas_Contig716.22   1   MRIKKKNTSGNARNFITRSQAVRKLQVSLADFRRLCIFKGIYPREPRNKK   50
WashU_Skud_Contig1325.4   1   MRIKKKNTRGNARNFITRSQAVRKLQVSLADFRRLCIFKGIYPREPRNKK   50
Symbols






******** *****************************************



SGD_Scer_NOP7/YGR103W   51   KANKGSTAPTTFYYAKDIQYLMHEPVLAKFREHKTFARKLTRALGRGEVS   100
MIT_Smik_c527_8616   51   KANKGSTAPTTFYYAKDIQYLMHEPVLAKFREHKTFARKLTRALGRGEVS   100
MIT_Spar_c4_8024   51   KANKGSTAPTTFYYAKDIQYLMHEPVLAKFREHKTFARKLTRALGRGEVS   100
MIT_Suva_c351_9191   51   KANKGSTAPTTFYYAKDIQYLMHEPVLAKFREHKTFARKLTRALGRGEVS   100
WashU_Sbay_Contig642.35   51   KANKGSTAPTTFYYAKDIQYLMHEPVLAKFREHKTFARKLTRALGRGEVS   100
WashU_Scas_Contig716.22   51   KANKGSTAPTTFYYTKDIQYLMHEPVLAKFREHKTFAKKLTRALGRGEVS   100
WashU_Skud_Contig1325.4   51   KANKGSTAPTTFYYAKDIQYLMHEPVLAKFREHKTFARKLTRALGRGEVS   100
Symbols






**************:**********************:************



SGD_Scer_NOP7/YGR103W   101   SAKRLEENRDSYTLDHIIKERYPSFPDAIRDIDDALNMLFLFSNLPSTNQ   150
MIT_Smik_c527_8616   101   SAKRLEENRDTYTLDHVIKERYPSFPDALRDIDDALNMLFLFSNLPSTNQ   150
MIT_Spar_c4_8024   101   SAKRLEENRDTYTLDHIIKERYPSFPDALRDIDDALNMLFLFSNLPSTNQ   150
MIT_Suva_c351_9191   101   SAKRLEENRDTYTLDHIIKERYPSFPDALRDIDDALNMLFLFSNLPSTNQ   150
WashU_Sbay_Contig642.35   101   SAKRLEENRDTYTLDHIIKERYPSFPDALRDIDDALNMLFLFSNLPSTNQ   150
WashU_Scas_Contig716.22   101   SAKKLEQNRSTYKLDHIIKERYPSFPDAVADLDDALNMLFLFANLPATSQ   150
WashU_Skud_Contig1325.4   101   SAKRLEGNRDTYTLDHIIKERYPSFPDALRDIDDALNMLFLFSNLPSTNQ   150
Symbols






***:** **.:*.***:***********: *:**********:***:*.*



SGD_Scer_NOP7/YGR103W   151   VSSKIINDAQKICNQWLAYVAKERLVRKVFVSIKGVYYQANIKGEEVRWL   200
MIT_Smik_c527_8616   151   VSSKIISDAQKICNQWLAYVAKERLVRKVFVSIKGVYYQAKIKGEEVRWL   200
MIT_Spar_c4_8024   151   VSSKIINDAQKICNQWLAYVAKERLVRKVFVSIKGVYYQANIKGEEVRWL   200
MIT_Suva_c351_9191   151   VSSNIVSDAQKLCNQWLAYVAKERLVRKVFVSIKGVYYQANIKGEEVRWL   200
WashU_Sbay_Contig642.35   151   VSSNIVSDAQKLCNQWLAYVAKERLVRKVFVSIKGVYYQANIKGEEVRWL   200
WashU_Scas_Contig716.22   151   VSSRVTNDARAICNQWLAYVARERLVRKVFVSIKGVYYQANVMGEDVRWL   200
WashU_Skud_Contig1325.4   151   VSSKIIGDTQKICNQWLAYVAKERLIRKVFVSIKGVYYQANIKGEEVRWL   200
Symbols






***.: .*:: :*********:***:**************:: **:****



SGD_Scer_NOP7/YGR103W   201   VPFKFPENIPSDVDFRIMLTFLEFYSTLLHFVLYKLYTDSGLIYPPKLDL   250
MIT_Smik_c527_8616   201   VPFKFPENIPSDVDFRIMLTFLEFYSTLLHFVLYKLYTDSGLIYPPKLDL   250
MIT_Spar_c4_8024   201   VPFKFPENIPSDVDFRIMLTFLEFYSTLLHFVLYKLYTDSGLIYPPKLDL   250
MIT_Suva_c351_9191   201   VPFKFPENIPSDVDFRIMLTFLEFYSTLLHFVLYKLYTDSGLIYPPKLDL   250
WashU_Sbay_Contig642.35   201   VPFKFPENIPSDVDFRIMLTFLEFYSTLLHFVLYKLYTDSGLIYPPKLDL   250
WashU_Scas_Contig716.22   201   VPFKFPENIPSDIDFRIMLTFLEFYSTLLHFVLFKLYTDRDLIYPPKLDL   250
WashU_Skud_Contig1325.4   201   VPFKFPENIPSDVDFRIMLTFLEFYSTLLHFVLYKLYTDSGLIYPPKLDL   250
Symbols






************:********************:***** .*********



SGD_Scer_NOP7/YGR103W   251   KKDKIISGLSSYILESRQEDSLLKLDPTEIEEDVKVESLDASTLKSALNA   300
MIT_Smik_c527_8616   251   EKDKIISGLSSYILESRKEDSLLKHDPTEIKKDVQVESLDASTLKSALNA   300
MIT_Spar_c4_8024   251   KKDKIISGLSSYILESRQEDSLLKHDPTEMEEDVQVESLDASTLKSALNA   300
MIT_Suva_c351_9191   251   EKDKIISGLSSYILESRQEDNLLQHEPAEIKEDAQVGTLDASTLKSALNA   300
WashU_Sbay_Contig642.35   251   EKDKIISGLSSYILESRQEDNLLQHEPAEIKEDAQVGTLDASTLKSALNA   300
WashU_Scas_Contig716.22   251   EKDKIISGLSSYILES-QEDSNTNAPALSTPSTDVVQTLDSKTLKSALNA   299
WashU_Skud_Contig1325.4   251   EKDKIISGLSSYILESGQEDNLLQLDPTDVKKDVQIESLDASTLKSALNA   300
Symbols






:*************** :**. : . . . : :**:.********



SGD_Scer_NOP7/YGR103W   301   DEANTDETEKEEEQEKKQEKEQEKEQNEETELDTFEDNNKNKGDILIQPS   350
MIT_Smik_c527_8616   301   DEANTEETNKEEQEEKEQELEQEKEQNDETELDTFEDNNKNKGDILVQPS   350
MIT_Spar_c4_8024   301   DEANTDETKKDEEEEKEQGLDQEKELNEETELDTFEDNNKNKGDILIQPS   350
MIT_Suva_c351_9191   301   DKAKLEETSKEEQE---QEQEQEQEQNEETELDTFVDNNKNKGDILIQPT   347
WashU_Sbay_Contig642.35   301   DKAKLEETSKEEQE---QEQEQEQEQNEETELDTFVDNNKNKGDILIQPT   347
WashU_Scas_Contig716.22   300   DDKEEDEEEKDAEE---------QERVETVKLDEFEDNSKNKGDVLAQPT   340
WashU_Skud_Contig1325.4   301   DEANREETNEEEREEREQELEQELEQNEEAELDIFEDKNKNKGDVLVQPS   350
Symbols






*. : :* .:: .: * : .:** * *:.*****:* **:



SGD_Scer_NOP7/YGR103W   351   KYDSPVASLFSAFVFYVSREVPIDILEFLILSCGGNVISEAAMDQIENKK   400
MIT_Smik_c527_8616   351   KYDSPVASLFSDFVFYVGREVPIDILEFLILSCGGSVISESTLDQIDNKA   400
MIT_Spar_c4_8024   351   KYDSPVASLFSDFAFYVSREVPIDILEFLILSCGGNVISEATLDQIENKK   400
MIT_Suva_c351_9191   348   KYDSPVAALYSDFVFYIGREVPIDILEFLILSCGGNVISEAALDQIEGKK   397
WashU_Sbay_Contig642.35   348   KYDSPVAALYSDFVFYIGREVPIDILEFLILSCGGNVISEAALDQIEGKK   397
WashU_Scas_Contig716.22   341   EFNSPVATLFQDFVFYIGREVPLDIIEFLILSCGGNLISEAALDQLENKD   390
WashU_Skud_Contig1325.4   351   KYDSPAASLFSNFSFYVGREVPIDILEFLILSCGGNIISEAALDRIENKK   400
Symbols






:::**.*:*:. * **:.****:**:*********.:***:::*:::.*



SGD_Scer_NOP7/YGR103W   401   DIDMSKVTHQIVDRPVLKNKVAGRTYIQPQWIFDCINKGELVPANKYLPG   450
MIT_Smik_c527_8616   401   DIDTSKITHHIVDRPVLKNKVAGRTYVQPQWIFDCINKGELVPANKYLPG   450
MIT_Spar_c4_8024   401   DIDISKVTHQIVDRPVLKNKVAGRTYIQPQWVFDCINKGELVPANKYLPG   450
MIT_Suva_c351_9191   398   DIDMSKITHQIVDRPVLKNKVAGRTYIQPQWVFDCINKGELVPANRYLPG   447
WashU_Sbay_Contig642.35   398   DIDMSKITHQIVDRPVLKNKVAGRTYIQPQWVFDCINKGELVPANRYLPG   447
WashU_Scas_Contig716.22   391   DIDLSKITHQIVDRPVLKNKIAGRTYIQPQWIFDCINKSELVPANLYLPG   440
WashU_Skud_Contig1325.4   401   DIDMSKITHQIVDRPALKNKVAGRTYIQPQWIFDCINKGELVPANKYLPG   450
Symbols






*** **:**:*****.****:*****:****:******.****** ****



SGD_Scer_NOP7/YGR103W   451   EALPPHLSPWGDAIGYDPTAPVEEGEEEESESESESEDQVEEEDQEVVAG   500
MIT_Smik_c527_8616   451   EALPPHLSPWGDAIGYDPTAPVEEGEENESES----EVEVEEDDQEVLVG   496
MIT_Spar_c4_8024   451   EALPPHLSPWGDAIGYDPTAPVEDGEEEESESESEG--QVEEEDQEVVAG   498
MIT_Suva_c351_9191   448   ETLPPHLSPWGDAIGYDPSAPVEEGEESESES----EAEVEEEDQQVVVE   493
WashU_Sbay_Contig642.35   448   ETLPPHLSPWGDAIGYDPSAPVEEGEESESES----EAEVEEEDQQVVVE   493
WashU_Scas_Contig716.22   441   ETLPPHLSPWGDATGYNPDAEVEENEEDAEASES--EAEVDDADADEQEN   488
WashU_Skud_Contig1325.4   451   EALPPHLSPWGDALGYDPTAPVEEGEESESEAEAEVEVAEDDQE----VV   496
Symbols






*:*********** **:* * **:.**. . : :: :



SGD_Scer_NOP7/YGR103W   501   EED-DDDDEELQAQKELELEAQGIKYSETSEADKDVNK--SKNKKRKVDE   547
MIT_Smik_c527_8616   497   EEDDEEEEEELQAQKELELEAQGIKYSETSEAAKNVTK--SKNKKRKVDE   544
MIT_Spar_c4_8024   499   EDDEDDDDEELKAQKELELEAQGIKYSETSEADKDVTK--SKNKKRKVDE   546
MIT_Suva_c351_9191   494   GEEDEEEDEELQAQKELELEAQGVKYSEAPEASKGANK--PKNKKRKVDE   541
WashU_Sbay_Contig642.35   494   GEEDEEEDEELQAQKELELEAQGVKYSEAPEASKGANK--PKNKKRKVDE   541
WashU_Scas_Contig716.22   489   AEESEEDDEELRAQKELELEAQGVTYTEAKETTEDSSKPTKASKKRKLTE   538
WashU_Skud_Contig1325.4   497   PEEDDEDDEELQAQKELELEAQGVKYSEA-DASKDATK--PKNKKRKIDE   543
Symbols






:: ::::***:***********:.*:*: :: :. .* .****: *



SGD_Scer_NOP7/YGR103W   548   EEEEKKLKMIMMSNKQKKLYKKMKYSNAKKEEQAENLKKKKKQIAKQKAK   597
MIT_Smik_c527_8616   545   EDEEKKLKMIMMSNNKRNLHKMKYSN------------------------   570
MIT_Spar_c4_8024   547   EEEEKKLKMIMMSNKQKKLYKKMKYSNAKKEEQAENLKKKKKQIAKQKAK   596
MIT_Suva_c351_9191   542   EEEEKKLKMIMMSNKQKKLYKKMKYSNSKKEEQTESLKKKKKQIAKQKAK   591
WashU_Sbay_Contig642.35   542   EEEEKKLKMIMMSNKQKKLYKKMKYSNSKKEEQTESLKKKKKQIAKQKAK   591
WashU_Scas_Contig716.22   539   EEEEKNLKMIMMSNKQRKLYKKMQYSNNQKEDKIENLKKKKKQIAKTKSK   588
WashU_Skud_Contig1325.4   544   EEEEKKLKMIMMSNKQKKLYKKMKYSNAKKEEQTESLKKKKKQIAKHKAK   593
Symbols






*:***:********::::*:* .



SGD_Scer_NOP7/YGR103W   598   LNKLDSKK   605
MIT_Smik_c527_8616   
   --------   
MIT_Spar_c4_8024   597   LSKLNSKK   604
MIT_Suva_c351_9191   592   LGKLNSKK   599
WashU_Sbay_Contig642.35   592   LGKLNSKK   599
WashU_Scas_Contig716.22   589   LAKLDKK-   595
WashU_Skud_Contig1325.4   594   LGKLNSKK   601
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_NOP7/YGR103W:

SGD_Scer_NOP7/YGR103W  Length: 606  Mon Nov  7 15:29:14 2016  Type: P  Check: 8791  ..

       1  MRIKKKNTRG NARNFITRSQ AVRKLQVSLA DFRRLCIFKG IYPREPRNKK

      51  KANKGSTAPT TFYYAKDIQY LMHEPVLAKF REHKTFARKL TRALGRGEVS

     101  SAKRLEENRD SYTLDHIIKE RYPSFPDAIR DIDDALNMLF LFSNLPSTNQ

     151  VSSKIINDAQ KICNQWLAYV AKERLVRKVF VSIKGVYYQA NIKGEEVRWL

     201  VPFKFPENIP SDVDFRIMLT FLEFYSTLLH FVLYKLYTDS GLIYPPKLDL

     251  KKDKIISGLS SYILESRQED SLLKLDPTEI EEDVKVESLD ASTLKSALNA

     301  DEANTDETEK EEEQEKKQEK EQEKEQNEET ELDTFEDNNK NKGDILIQPS

     351  KYDSPVASLF SAFVFYVSRE VPIDILEFLI LSCGGNVISE AAMDQIENKK

     401  DIDMSKVTHQ IVDRPVLKNK VAGRTYIQPQ WIFDCINKGE LVPANKYLPG

     451  EALPPHLSPW GDAIGYDPTA PVEEGEEEES ESESESEDQV EEEDQEVVAG

     501  EEDDDDDEEL QAQKELELEA QGIKYSETSE ADKDVNKSKN KKRKVDEEEE

     551  EKKLKMIMMS NKQKKLYKKM KYSNAKKEEQ AENLKKKKKQ IAKQKAKLNK

     601  LDSKK*

Protein Sequence for MIT_Smik_c527_8616:

MIT_Smik_c527_8616  Length: 570  Mon Nov  7 15:29:14 2016  Type: P  Check: 4415  ..

       1  MRIKKKNTRG NARNFITRSQ AVRKLQVSLA DFRRLCIFKG IYPREPRNKK

      51  KANKGSTAPT TFYYAKDIQY LMHEPVLAKF REHKTFARKL TRALGRGEVS

     101  SAKRLEENRD TYTLDHVIKE RYPSFPDALR DIDDALNMLF LFSNLPSTNQ

     151  VSSKIISDAQ KICNQWLAYV AKERLVRKVF VSIKGVYYQA KIKGEEVRWL

     201  VPFKFPENIP SDVDFRIMLT FLEFYSTLLH FVLYKLYTDS GLIYPPKLDL

     251  EKDKIISGLS SYILESRKED SLLKHDPTEI KKDVQVESLD ASTLKSALNA

     301  DEANTEETNK EEQEEKEQEL EQEKEQNDET ELDTFEDNNK NKGDILVQPS

     351  KYDSPVASLF SDFVFYVGRE VPIDILEFLI LSCGGSVISE STLDQIDNKA

     401  DIDTSKITHH IVDRPVLKNK VAGRTYVQPQ WIFDCINKGE LVPANKYLPG

     451  EALPPHLSPW GDAIGYDPTA PVEEGEENES ESEVEVEEDD QEVLVGEEDD

     501  EEEEEELQAQ KELELEAQGI KYSETSEAAK NVTKSKNKKR KVDEEDEEKK

     551  LKMIMMSNNK RNLHKMKYSN

Protein Sequence for MIT_Spar_c4_8024:

MIT_Spar_c4_8024  Length: 605  Mon Nov  7 15:29:14 2016  Type: P  Check: 6961  ..

       1  MRIKKKNTRG NARNFITRSQ AVRKLQVSLA DFRRLCIFKG IYPREPRNKK

      51  KANKGSTAPT TFYYAKDIQY LMHEPVLAKF REHKTFARKL TRALGRGEVS

     101  SAKRLEENRD TYTLDHIIKE RYPSFPDALR DIDDALNMLF LFSNLPSTNQ

     151  VSSKIINDAQ KICNQWLAYV AKERLVRKVF VSIKGVYYQA NIKGEEVRWL

     201  VPFKFPENIP SDVDFRIMLT FLEFYSTLLH FVLYKLYTDS GLIYPPKLDL

     251  KKDKIISGLS SYILESRQED SLLKHDPTEM EEDVQVESLD ASTLKSALNA

     301  DEANTDETKK DEEEEKEQGL DQEKELNEET ELDTFEDNNK NKGDILIQPS

     351  KYDSPVASLF SDFAFYVSRE VPIDILEFLI LSCGGNVISE ATLDQIENKK

     401  DIDISKVTHQ IVDRPVLKNK VAGRTYIQPQ WVFDCINKGE LVPANKYLPG

     451  EALPPHLSPW GDAIGYDPTA PVEDGEEEES ESESEGQVEE EDQEVVAGED

     501  DEDDDDEELK AQKELELEAQ GIKYSETSEA DKDVTKSKNK KRKVDEEEEE

     551  KKLKMIMMSN KQKKLYKKMK YSNAKKEEQA ENLKKKKKQI AKQKAKLSKL

     601  NSKK*

Protein Sequence for MIT_Suva_c351_9191:

MIT_Suva_c351_9191  Length: 600  Mon Nov  7 15:29:14 2016  Type: P  Check: 6945  ..

       1  MRIKKKNTRG NARNFITRSQ AVRKLQVSLA DFRRLCIFKG IYPREPRNKK

      51  KANKGSTAPT TFYYAKDIQY LMHEPVLAKF REHKTFARKL TRALGRGEVS

     101  SAKRLEENRD TYTLDHIIKE RYPSFPDALR DIDDALNMLF LFSNLPSTNQ

     151  VSSNIVSDAQ KLCNQWLAYV AKERLVRKVF VSIKGVYYQA NIKGEEVRWL

     201  VPFKFPENIP SDVDFRIMLT FLEFYSTLLH FVLYKLYTDS GLIYPPKLDL

     251  EKDKIISGLS SYILESRQED NLLQHEPAEI KEDAQVGTLD ASTLKSALNA

     301  DKAKLEETSK EEQEQEQEQE QEQNEETELD TFVDNNKNKG DILIQPTKYD

     351  SPVAALYSDF VFYIGREVPI DILEFLILSC GGNVISEAAL DQIEGKKDID

     401  MSKITHQIVD RPVLKNKVAG RTYIQPQWVF DCINKGELVP ANRYLPGETL

     451  PPHLSPWGDA IGYDPSAPVE EGEESESESE AEVEEEDQQV VVEGEEDEEE

     501  DEELQAQKEL ELEAQGVKYS EAPEASKGAN KPKNKKRKVD EEEEEKKLKM

     551  IMMSNKQKKL YKKMKYSNSK KEEQTESLKK KKKQIAKQKA KLGKLNSKK*


Protein Sequence for WashU_Sbay_Contig642.35:

WashU_Sbay_Contig642.35  Length: 600  Mon Nov  7 15:29:14 2016  Type: P  Check: 6945  ..

       1  MRIKKKNTRG NARNFITRSQ AVRKLQVSLA DFRRLCIFKG IYPREPRNKK

      51  KANKGSTAPT TFYYAKDIQY LMHEPVLAKF REHKTFARKL TRALGRGEVS

     101  SAKRLEENRD TYTLDHIIKE RYPSFPDALR DIDDALNMLF LFSNLPSTNQ

     151  VSSNIVSDAQ KLCNQWLAYV AKERLVRKVF VSIKGVYYQA NIKGEEVRWL

     201  VPFKFPENIP SDVDFRIMLT FLEFYSTLLH FVLYKLYTDS GLIYPPKLDL

     251  EKDKIISGLS SYILESRQED NLLQHEPAEI KEDAQVGTLD ASTLKSALNA

     301  DKAKLEETSK EEQEQEQEQE QEQNEETELD TFVDNNKNKG DILIQPTKYD

     351  SPVAALYSDF VFYIGREVPI DILEFLILSC GGNVISEAAL DQIEGKKDID

     401  MSKITHQIVD RPVLKNKVAG RTYIQPQWVF DCINKGELVP ANRYLPGETL

     451  PPHLSPWGDA IGYDPSAPVE EGEESESESE AEVEEEDQQV VVEGEEDEEE

     501  DEELQAQKEL ELEAQGVKYS EAPEASKGAN KPKNKKRKVD EEEEEKKLKM

     551  IMMSNKQKKL YKKMKYSNSK KEEQTESLKK KKKQIAKQKA KLGKLNSKK*


Protein Sequence for WashU_Scas_Contig716.22:

WashU_Scas_Contig716.22  Length: 596  Mon Nov  7 15:29:14 2016  Type: P  Check: 9855  ..

       1  MRIKKKNTSG NARNFITRSQ AVRKLQVSLA DFRRLCIFKG IYPREPRNKK

      51  KANKGSTAPT TFYYTKDIQY LMHEPVLAKF REHKTFAKKL TRALGRGEVS

     101  SAKKLEQNRS TYKLDHIIKE RYPSFPDAVA DLDDALNMLF LFANLPATSQ

     151  VSSRVTNDAR AICNQWLAYV ARERLVRKVF VSIKGVYYQA NVMGEDVRWL

     201  VPFKFPENIP SDIDFRIMLT FLEFYSTLLH FVLFKLYTDR DLIYPPKLDL

     251  EKDKIISGLS SYILESQEDS NTNAPALSTP STDVVQTLDS KTLKSALNAD

     301  DKEEDEEEKD AEEQERVETV KLDEFEDNSK NKGDVLAQPT EFNSPVATLF

     351  QDFVFYIGRE VPLDIIEFLI LSCGGNLISE AALDQLENKD DIDLSKITHQ

     401  IVDRPVLKNK IAGRTYIQPQ WIFDCINKSE LVPANLYLPG ETLPPHLSPW

     451  GDATGYNPDA EVEENEEDAE ASESEAEVDD ADADEQENAE ESEEDDEELR

     501  AQKELELEAQ GVTYTEAKET TEDSSKPTKA SKKRKLTEEE EEKNLKMIMM

     551  SNKQRKLYKK MQYSNNQKED KIENLKKKKK QIAKTKSKLA KLDKK*


Protein Sequence for WashU_Skud_Contig1325.4:

WashU_Skud_Contig1325.4  Length: 602  Mon Nov  7 15:29:14 2016  Type: P  Check: 8396  ..

       1  MRIKKKNTRG NARNFITRSQ AVRKLQVSLA DFRRLCIFKG IYPREPRNKK

      51  KANKGSTAPT TFYYAKDIQY LMHEPVLAKF REHKTFARKL TRALGRGEVS

     101  SAKRLEGNRD TYTLDHIIKE RYPSFPDALR DIDDALNMLF LFSNLPSTNQ

     151  VSSKIIGDTQ KICNQWLAYV AKERLIRKVF VSIKGVYYQA NIKGEEVRWL

     201  VPFKFPENIP SDVDFRIMLT FLEFYSTLLH FVLYKLYTDS GLIYPPKLDL

     251  EKDKIISGLS SYILESGQED NLLQLDPTDV KKDVQIESLD ASTLKSALNA

     301  DEANREETNE EEREEREQEL EQELEQNEEA ELDIFEDKNK NKGDVLVQPS

     351  KYDSPAASLF SNFSFYVGRE VPIDILEFLI LSCGGNIISE AALDRIENKK

     401  DIDMSKITHQ IVDRPALKNK VAGRTYIQPQ WIFDCINKGE LVPANKYLPG

     451  EALPPHLSPW GDALGYDPTA PVEEGEESES EAEAEVEVAE DDQEVVPEED

     501  DEDDEELQAQ KELELEAQGV KYSEADASKD ATKPKNKKRK IDEEEEEKKL

     551  KMIMMSNKQK KLYKKMKYSN AKKEEQTESL KKKKKQIAKH KAKLGKLNSK

     601  K*