Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YGL256W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_ADH4/YGL256W   1   ---------------------------------------------MSSVT   5
MIT_Smik_c349_6875   1   --MYKRLANISKLFDIGVTRFSSSYPKRTINNKLVFATTNNQLRKMSSVT   48
MIT_Spar_c283_7744   1   --MYKRVISISSSLKTGIKRFSSIYSERTINNKFIFATTNSQLRKMSSVT   48
MIT_Suva_c815_7149   1   --MYKGVNAFANPLRTGITRFFSTSIKRTFNNKLIFATGSIQSRKLSSVT   48
WashU_Sbay_Contig619.18   1   --MYKGVNAFANPLRTGITRFFSTSIKRTFNNKLIFATGSIQSRKLSSVT   48
WashU_Sklu_Contig2409.3   1   ---------------------------------------------MSSVT   5
WashU_Skud_Contig2049.8   1   MNMYKKVTGISNPLKAGISHFFSTFSKRTVNNKLIFATTNYQLRKMSSVT   50
WashU_Smik_Contig2473.2   1   --MYKRLANISKLFDIGVTRFSSSYPKRTINNKLVFATTNNQLRKMSSVT   48
Symbols






:****



SGD_Scer_ADH4/YGL256W   6   GFYIPPISFFGEGALEETADYIKNKDYKKALIVTDPGIAAIGLSGRVQKM   55
MIT_Smik_c349_6875   49   GFYIPPISFFGEGALEGTADYIKNKDYKKALIVTDPGIAAIGLSGRVQKM   98
MIT_Spar_c283_7744   49   GFYIPPISFFGEGALEETADYIKNKDYKKALIVTDPGIAAIGLSGRVQKM   98
MIT_Suva_c815_7149   49   GFYIPPISFFGEGALEETADFIQNKEYKRALIVTDPGIAAIGLSGRVQKM   98
WashU_Sbay_Contig619.18   49   GFYIPPISFFGEGALEETADFIQNKEYKRALIVTDPGIAAIGLSGRVQKM   98
WashU_Sklu_Contig2409.3   6   GFYSPPISYFGEGALEEAADYIKTREFSRALIVTDPGIVKIGLAAKVTKL   55
WashU_Skud_Contig2049.8   51   GFYIPPISFFGEGALEETVDYIKNKDYKKALIVTDPGIAAIGLSGRVQKM   100
WashU_Smik_Contig2473.2   49   GFYIPPISFFGEGALEETADYIKNKDYKKALIVTDPGIAAIGLSGRVQKM   98
Symbols






*** ****:******* :.*:*:.:::.:*********. ***:.:* *:



SGD_Scer_ADH4/YGL256W   56   LEERDLNVAIYDKTQPNPNIANVTAGLKVLKEQNSEIVVSIGGGSAHDNA   105
MIT_Smik_c349_6875   99   LEERGLNVAVYDQTQPNPNVGNVLAGLKVLKEQNSEIVVSIGGGSAHDNA   148
MIT_Spar_c283_7744   99   LEERGLNVAIYDKTQPNPNVANVTAGLKVLKEQDSEIVVSIGGGSAHDNA   148
MIT_Suva_c815_7149   99   LEERGLDVAVYDQTQPNPNTGNVLDGLKVLRKQDSEIVVSIGGGSAHDNA   148
WashU_Sbay_Contig619.18   99   LEERGLDVAVYDQTQPNPNTGNVLDGLKVLRKQDSEIVVSIGGGSAHDNA   148
WashU_Sklu_Contig2409.3   56   LEDRGLTVAIYDQTQPNPNIGNVEDGLKVLKENNSEIVVSIGGGSAHDNA   105
WashU_Skud_Contig2049.8   101   LEESGLNVAIYDQTQPNPNVGNVLAGLKVLKQQNSEIVVSIGGGSAHDNA   150
WashU_Smik_Contig2473.2   99   LEERGLNVAVYDQTQPNPNVGNVLAGLKVLKEQNSEIVVSIGGGSAHDNA   148
Symbols






**: .* **:**:****** .** *****::::****************



SGD_Scer_ADH4/YGL256W   106   KAIALLATNGGEIGDYEGVNQSKKAALPLFAINTTAGTASEMTRFTIISN   155
MIT_Smik_c349_6875   149   KAIALLATNGGEIGDYEGVNQSKKASLPLFAINTTAGTASEMTRFTIISN   198
MIT_Spar_c283_7744   149   KAIALLATNGGEIGDYEGVNQSKKAALPLFAINTTAGTASEMTRFTIISN   198
MIT_Suva_c815_7149   149   KAIALLATNGGEIGDYEGLNRSKKAALPLFAINTTAGTASEMTRFTIISN   198
WashU_Sbay_Contig619.18   149   KAIALLATNGGEIGDYEGLNRSKKAALPLFAINTTAGTASEMTRFTIISN   198
WashU_Sklu_Contig2409.3   106   KAIALLATNGGEIKDYEGVNKSKKSSLPLFAVNTTAGTASELTRFTIISN   155
WashU_Skud_Contig2049.8   151   KAIALLATNGGEIGDYEGVNQSKKAALPLFAINTTAGTASEMTRFTIISN   200
WashU_Smik_Contig2473.2   149   KAIALLATNGGEIGDYEGVNQSKKASLPLFAINTTAGTASEMTRFTIISN   198
Symbols






************* ****:*:***::*****:*********:********



SGD_Scer_ADH4/YGL256W   156   EEKKIKMAIIDNNVTPAVAVNDPSTMFGLPPALTAATGLDALTHCIEAYV   205
MIT_Smik_c349_6875   199   EEKKIKMAIIDNNVTPAVAVNDPSTMFGLPPALTAATGLDALTHCIEAYV   248
MIT_Spar_c283_7744   199   EEKKIKMAIIDNNVTPAVAVNDPSTMFGLPPPLTAATGLDALTHCIEAYV   248
MIT_Suva_c815_7149   199   EEKKVKMAIIDNNVTPAVAVNDPSTMFGLPPALTAATGLDALTHCIEAFV   248
WashU_Sbay_Contig619.18   199   EEKKVKMAIIDNNVTPAVAVNDPSTMFGLPPALTAATGLDALTHCIEAFV   248
WashU_Sklu_Contig2409.3   156   EEKKVKMAIIDNNVTPAVAINDPSTMYGLPPSLTAATGLDALTHCIEAYV   205
WashU_Skud_Contig2049.8   201   EEKKIKMAIIDNNVTPAVAVNDPSTMYGLPPALTAATGLDALTHCIEAFV   250
WashU_Smik_Contig2473.2   199   EEKKIKMAIIDNNVTPAVAVNDPSTMFGLPPALTAATGLDALTHCIEAYV   248
Symbols






****:**************:******:****.****************:*



SGD_Scer_ADH4/YGL256W   206   STASNPITDACALKGIDLINESLVAAYKDGKDKKARTDMCYAEYLAGMAF   255
MIT_Smik_c349_6875   249   STASNPITDACALKGIDLIKESLVSAYNNGKDKKARTDMCYAEYLAGMAF   298
MIT_Spar_c283_7744   249   STASNPITDACALKGIDLINESLVAAYNNGKDKKARTDMCYAEYLAGMAF   298
MIT_Suva_c815_7149   249   STASNPITDACALKGIDLIQESLVNAYNNGSDKKARTDMCYGEYLAGMAF   298
WashU_Sbay_Contig619.18   249   STASNPITDACALKGIDLIQESLVNAYNNGSDKKARTDMCYGEYLAGMAF   298
WashU_Sklu_Contig2409.3   206   STAADPITDACALKGVDLINESLIAAFKNGSDKKARTDMCYAEYLAGMAF   255
WashU_Skud_Contig2049.8   251   STASNPITDACALKGIDLIDESLISAYKNGKDKKARTDMCYAEYLAGMAF   300
WashU_Smik_Contig2473.2   249   STASNPITDACALKGIDLIKESLVSAYNNGKDKKARTDMCYAEYLAGMAF   298
Symbols






***::**********:***.***: *:::*.**********.********



SGD_Scer_ADH4/YGL256W   256   NNASLGYVHALAHQLGGFYHLPHGVCNAVLLPHVQEANMQCPKAKKRLGE   305
MIT_Smik_c349_6875   299   NNASLGYVHAIAHQLGGFYHLPHGVCNAVLLPHVQEFNMECPKAKKRLGE   348
MIT_Spar_c283_7744   299   NNASLGYVHALAHQLGGFYHLPHGVCNAVLLPHVQEANMQCPKAKKRLGE   348
MIT_Suva_c815_7149   299   NNASLGYVHAIAHQLGGFYHLPHGVCNAVLLPHVQEFNMECPKAKKRLGE   348
WashU_Sbay_Contig619.18   299   NNASLGYVHAIAHQLGGFYHLPHGVCNAVLLPHVQEFNMECPKAKKRLGE   348
WashU_Sklu_Contig2409.3   256   NNASLGYVHAIAHQLGGFYHLPHGVCNAVLLPHVQDFNKACEKAGKRLGD   305
WashU_Skud_Contig2049.8   301   NNASLGYVHAIAHQLGGFYHLPHGVCNAVLLPHVQESNMQCPKAKKRLGE   350
WashU_Smik_Contig2473.2   299   NNASLGYVHAIAHQLGGFYHLPHGVCNAVLLPHVQEFNMECPKAKKRLGE   348
Symbols






**********:************************: * * ** ****:



SGD_Scer_ADH4/YGL256W   306   IALHFGASQEDPEETIKALHVLNRTMNIPRNLKELGVKTEDFEILAEHAM   355
MIT_Smik_c349_6875   349   IALHFGASEESPEETIKTLHAFNRTMNIPRNLKDLGVKTEDFGILADNAM   398
MIT_Spar_c283_7744   349   IALHFGASQEDPEETIKALHVLNRTMNIPRNLKDLGVKTEDFDILAEHAM   398
MIT_Suva_c815_7149   349   VALHVGASEANPEETIRILHAFNRTMNIPRNLKDLGVKTEDFGTLAENAM   398
WashU_Sbay_Contig619.18   349   VALHVGASEANPEETIRILHAFNRTMNIPRNLKDLGVKTEDFGTLAENAM   398
WashU_Sklu_Contig2409.3   306   VAVHFGLKEGTAESAIEYLHGMNRSLNIPRNLKELGVKPEDFEILAENAM   355
WashU_Skud_Contig2049.8   351   IALHLGATKEDPEETIKALHVFNRAMNIPRNLKDLGVKTEDFGILADNAM   400
WashU_Smik_Contig2473.2   349   IALHFGASEESPEETIKTLHAFNRTMNIPRNLKDLGVKTEDFGILADNAM   398
Symbols






:*:*.* .: .*.:*. ** :**::*******:****.*** **::**



SGD_Scer_ADH4/YGL256W   356   HDACHLTNPVQFTKEQVVAIIKKAYEY   382
MIT_Smik_c349_6875   399   NDACHLTNPVQFTKEQVVAILKQAYEY   425
MIT_Spar_c283_7744   399   HDACHLTNPVQFTKEQVVAILKKAYEY   425
MIT_Suva_c815_7149   399   KDACHVTNPVQFTKEQVVAILKQAYEY   425
WashU_Sbay_Contig619.18   399   KDACHVTNPVQFTKEQVVAILKQAYEY   425
WashU_Sklu_Contig2409.3   356   VDACHLTNPIQFTKDEVIAILKQAYEY   382
WashU_Skud_Contig2049.8   401   NDACHLTNPVQFTKEQVIAILRQSYEY   427
WashU_Smik_Contig2473.2   399   NDACHLTNPVQFTKEQVVAILKQAYEY   425
Symbols






****:***:****::*:**::::***



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_ADH4/YGL256W:

SGD_Scer_ADH4/YGL256W  Length: 383  Mon Nov  7 15:26:57 2016  Type: P  Check: 8536  ..

       1  MSSVTGFYIP PISFFGEGAL EETADYIKNK DYKKALIVTD PGIAAIGLSG

      51  RVQKMLEERD LNVAIYDKTQ PNPNIANVTA GLKVLKEQNS EIVVSIGGGS

     101  AHDNAKAIAL LATNGGEIGD YEGVNQSKKA ALPLFAINTT AGTASEMTRF

     151  TIISNEEKKI KMAIIDNNVT PAVAVNDPST MFGLPPALTA ATGLDALTHC

     201  IEAYVSTASN PITDACALKG IDLINESLVA AYKDGKDKKA RTDMCYAEYL

     251  AGMAFNNASL GYVHALAHQL GGFYHLPHGV CNAVLLPHVQ EANMQCPKAK

     301  KRLGEIALHF GASQEDPEET IKALHVLNRT MNIPRNLKEL GVKTEDFEIL

     351  AEHAMHDACH LTNPVQFTKE QVVAIIKKAY EY*

Protein Sequence for MIT_Smik_c349_6875:

MIT_Smik_c349_6875  Length: 426  Mon Nov  7 15:26:57 2016  Type: P  Check: 4999  ..

       1  MYKRLANISK LFDIGVTRFS SSYPKRTINN KLVFATTNNQ LRKMSSVTGF

      51  YIPPISFFGE GALEGTADYI KNKDYKKALI VTDPGIAAIG LSGRVQKMLE

     101  ERGLNVAVYD QTQPNPNVGN VLAGLKVLKE QNSEIVVSIG GGSAHDNAKA

     151  IALLATNGGE IGDYEGVNQS KKASLPLFAI NTTAGTASEM TRFTIISNEE

     201  KKIKMAIIDN NVTPAVAVND PSTMFGLPPA LTAATGLDAL THCIEAYVST

     251  ASNPITDACA LKGIDLIKES LVSAYNNGKD KKARTDMCYA EYLAGMAFNN

     301  ASLGYVHAIA HQLGGFYHLP HGVCNAVLLP HVQEFNMECP KAKKRLGEIA

     351  LHFGASEESP EETIKTLHAF NRTMNIPRNL KDLGVKTEDF GILADNAMND

     401  ACHLTNPVQF TKEQVVAILK QAYEY*

Protein Sequence for MIT_Spar_c283_7744:

MIT_Spar_c283_7744  Length: 426  Mon Nov  7 15:26:57 2016  Type: P  Check: 2428  ..

       1  MYKRVISISS SLKTGIKRFS SIYSERTINN KFIFATTNSQ LRKMSSVTGF

      51  YIPPISFFGE GALEETADYI KNKDYKKALI VTDPGIAAIG LSGRVQKMLE

     101  ERGLNVAIYD KTQPNPNVAN VTAGLKVLKE QDSEIVVSIG GGSAHDNAKA

     151  IALLATNGGE IGDYEGVNQS KKAALPLFAI NTTAGTASEM TRFTIISNEE

     201  KKIKMAIIDN NVTPAVAVND PSTMFGLPPP LTAATGLDAL THCIEAYVST

     251  ASNPITDACA LKGIDLINES LVAAYNNGKD KKARTDMCYA EYLAGMAFNN

     301  ASLGYVHALA HQLGGFYHLP HGVCNAVLLP HVQEANMQCP KAKKRLGEIA

     351  LHFGASQEDP EETIKALHVL NRTMNIPRNL KDLGVKTEDF DILAEHAMHD

     401  ACHLTNPVQF TKEQVVAILK KAYEY*

Protein Sequence for MIT_Suva_c815_7149:

MIT_Suva_c815_7149  Length: 426  Mon Nov  7 15:26:57 2016  Type: P  Check: 3813  ..

       1  MYKGVNAFAN PLRTGITRFF STSIKRTFNN KLIFATGSIQ SRKLSSVTGF

      51  YIPPISFFGE GALEETADFI QNKEYKRALI VTDPGIAAIG LSGRVQKMLE

     101  ERGLDVAVYD QTQPNPNTGN VLDGLKVLRK QDSEIVVSIG GGSAHDNAKA

     151  IALLATNGGE IGDYEGLNRS KKAALPLFAI NTTAGTASEM TRFTIISNEE

     201  KKVKMAIIDN NVTPAVAVND PSTMFGLPPA LTAATGLDAL THCIEAFVST

     251  ASNPITDACA LKGIDLIQES LVNAYNNGSD KKARTDMCYG EYLAGMAFNN

     301  ASLGYVHAIA HQLGGFYHLP HGVCNAVLLP HVQEFNMECP KAKKRLGEVA

     351  LHVGASEANP EETIRILHAF NRTMNIPRNL KDLGVKTEDF GTLAENAMKD

     401  ACHVTNPVQF TKEQVVAILK QAYEY*

Protein Sequence for WashU_Sbay_Contig619.18:

WashU_Sbay_Contig619.18  Length: 426  Mon Nov  7 15:26:57 2016  Type: P  Check: 3813  ..

       1  MYKGVNAFAN PLRTGITRFF STSIKRTFNN KLIFATGSIQ SRKLSSVTGF

      51  YIPPISFFGE GALEETADFI QNKEYKRALI VTDPGIAAIG LSGRVQKMLE

     101  ERGLDVAVYD QTQPNPNTGN VLDGLKVLRK QDSEIVVSIG GGSAHDNAKA

     151  IALLATNGGE IGDYEGLNRS KKAALPLFAI NTTAGTASEM TRFTIISNEE

     201  KKVKMAIIDN NVTPAVAVND PSTMFGLPPA LTAATGLDAL THCIEAFVST

     251  ASNPITDACA LKGIDLIQES LVNAYNNGSD KKARTDMCYG EYLAGMAFNN

     301  ASLGYVHAIA HQLGGFYHLP HGVCNAVLLP HVQEFNMECP KAKKRLGEVA

     351  LHVGASEANP EETIRILHAF NRTMNIPRNL KDLGVKTEDF GTLAENAMKD

     401  ACHVTNPVQF TKEQVVAILK QAYEY*

Protein Sequence for WashU_Sklu_Contig2409.3:

WashU_Sklu_Contig2409.3  Length: 383  Mon Nov  7 15:26:57 2016  Type: P  Check: 9189  ..

       1  MSSVTGFYSP PISYFGEGAL EEAADYIKTR EFSRALIVTD PGIVKIGLAA

      51  KVTKLLEDRG LTVAIYDQTQ PNPNIGNVED GLKVLKENNS EIVVSIGGGS

     101  AHDNAKAIAL LATNGGEIKD YEGVNKSKKS SLPLFAVNTT AGTASELTRF

     151  TIISNEEKKV KMAIIDNNVT PAVAINDPST MYGLPPSLTA ATGLDALTHC

     201  IEAYVSTAAD PITDACALKG VDLINESLIA AFKNGSDKKA RTDMCYAEYL

     251  AGMAFNNASL GYVHAIAHQL GGFYHLPHGV CNAVLLPHVQ DFNKACEKAG

     301  KRLGDVAVHF GLKEGTAESA IEYLHGMNRS LNIPRNLKEL GVKPEDFEIL

     351  AENAMVDACH LTNPIQFTKD EVIAILKQAY EY*

Protein Sequence for WashU_Skud_Contig2049.8:

WashU_Skud_Contig2049.8  Length: 428  Mon Nov  7 15:26:57 2016  Type: P  Check: 7443  ..

       1  MNMYKKVTGI SNPLKAGISH FFSTFSKRTV NNKLIFATTN YQLRKMSSVT

      51  GFYIPPISFF GEGALEETVD YIKNKDYKKA LIVTDPGIAA IGLSGRVQKM

     101  LEESGLNVAI YDQTQPNPNV GNVLAGLKVL KQQNSEIVVS IGGGSAHDNA

     151  KAIALLATNG GEIGDYEGVN QSKKAALPLF AINTTAGTAS EMTRFTIISN

     201  EEKKIKMAII DNNVTPAVAV NDPSTMYGLP PALTAATGLD ALTHCIEAFV

     251  STASNPITDA CALKGIDLID ESLISAYKNG KDKKARTDMC YAEYLAGMAF

     301  NNASLGYVHA IAHQLGGFYH LPHGVCNAVL LPHVQESNMQ CPKAKKRLGE

     351  IALHLGATKE DPEETIKALH VFNRAMNIPR NLKDLGVKTE DFGILADNAM

     401  NDACHLTNPV QFTKEQVIAI LRQSYEY*

Protein Sequence for WashU_Smik_Contig2473.2:

WashU_Smik_Contig2473.2  Length: 426  Mon Nov  7 15:26:57 2016  Type: P  Check: 4983  ..

       1  MYKRLANISK LFDIGVTRFS SSYPKRTINN KLVFATTNNQ LRKMSSVTGF

      51  YIPPISFFGE GALEETADYI KNKDYKKALI VTDPGIAAIG LSGRVQKMLE

     101  ERGLNVAVYD QTQPNPNVGN VLAGLKVLKE QNSEIVVSIG GGSAHDNAKA

     151  IALLATNGGE IGDYEGVNQS KKASLPLFAI NTTAGTASEM TRFTIISNEE

     201  KKIKMAIIDN NVTPAVAVND PSTMFGLPPA LTAATGLDAL THCIEAYVST

     251  ASNPITDACA LKGIDLIKES LVSAYNNGKD KKARTDMCYA EYLAGMAFNN

     301  ASLGYVHAIA HQLGGFYHLP HGVCNAVLLP HVQEFNMECP KAKKRLGEIA

     351  LHFGASEESP EETIKTLHAF NRTMNIPRNL KDLGVKTEDF GILADNAMND

     401  ACHLTNPVQF TKEQVVAILK QAYEY*