Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YGL167C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_PMR1/YGL167C   1   MSDNPFNASLLDEDSNREREILDATAEALSKPSPSLEYCTLSVDEALEKL   50
MIT_Smik_c735_7219   1   MSDNPFNASLLDEDSNREREILDATAEALSKPSPSLEYCTLSVEETLERL   50
MIT_Spar_c469_7837   1   MSDNPFNASLLDEDSNREREILDATAEALSKPSPSLEYCTLSVDETLEKL   50
MIT_Suva_c403_8364   1   MSDNPFNGSLLDEDSNRERDIIDATTEALWKPNPSLEYGTLSVEETLEQL   50
WashU_Sbay_Contig674.36   1   MSDNPFNASLLDEDSNRERDIIDATTEALSKPNPSLEYCTLSVEETLEQL   50
WashU_Scas_Contig707.48   1   MSANPFDAPIADERSIEERELLEVAKEALSRPNASLEYCTMSVDETLRKL   50
Symbols






** ***:..: ** * .**::::.: *** :*..**** *:**:*:*.:*



SGD_Scer_PMR1/YGL167C   51   DTDKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILL   100
MIT_Smik_c735_7219   51   ETDKNSGLRSSNEANNRRSLYGPNEITVEDDENIFKKFLFNFIEDRMILL   100
MIT_Spar_c469_7837   51   DTDKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILL   100
MIT_Suva_c403_8364   51   QTDENNGLRSSSEATNRRALHGPNEITVEDDESLFKKFLSNFIEDRLILL   100
WashU_Sbay_Contig674.36   51   QTDENNGLRSSSEATNRRALHGPNEITVEDDESLFKKFLSNFIEDRLILL   100
WashU_Scas_Contig707.48   51   ETDPKSGLGSIAEASRRKLVYGANEIVIEEDESLWKKFLSSFVEDRLILL   100
Symbols






:** :.** * **..*: ::*.***.:*:**.::**** .*:***:***



SGD_Scer_PMR1/YGL167C   101   LIGSAVVSLFMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVP   150
MIT_Smik_c735_7219   101   LIGSAVVSLFMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVP   150
MIT_Spar_c469_7837   101   LIGSAVVSLFMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVP   150
MIT_Suva_c403_8364   101   LIGSAVVSFCMGNTDDAISITLAIFIVVTVGFVQEYRSEKSLEALNKLVP   150
WashU_Sbay_Contig674.36   101   LIGSAVVSFCMGNTDDAISITLAIFIVVTVGFVQEYRSEKSLEALNKLVP   150
WashU_Scas_Contig707.48   101   LIGSAVVSFIMGNIDDAVSITLAIVIVVSVGFVQEYRSEKSLEALNKLVP   150
Symbols






********: *** ***:******.***:*********************



SGD_Scer_PMR1/YGL167C   151   AECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDES   200
MIT_Smik_c735_7219   151   AECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADLRIIEATDLSIDES   200
MIT_Spar_c469_7837   151   AECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADLRIIEAIDLSIDES   200
MIT_Suva_c403_8364   151   AECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADLRIIEATDLTIDES   200
WashU_Sbay_Contig674.36   151   AECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADLRIIEATDLTIDES   200
WashU_Scas_Contig707.48   151   AECHLIRCGQESHVLASGLVPGDLVHFKIGDRIPADLRIIEAVDLSIDES   200
Symbols






*****:*********** *********:********:***** **:****



SGD_Scer_PMR1/YGL167C   201   NLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGK   250
MIT_Smik_c735_7219   201   NLTGENEPVHKSSQTIEKSSFNDQPNSIVPIAERSCIAYMGTLVKEGHGK   250
MIT_Spar_c469_7837   201   NLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGK   250
MIT_Suva_c403_8364   201   NLTGENEPVHKTSETIEKSSFNDQPNSIVPIAERTCIAYMGTLVKEGHGK   250
WashU_Sbay_Contig674.36   201   NLTGENEPVHKTSETIEKSSFNDQPNSIVPIAERTCIAYMGTLVKEGHGK   250
WashU_Scas_Contig707.48   201   NLTGENEPVHKSAKEVNKDSFNDQPNSIIPISDRTCVAYMGTLVKEGHGK   250
Symbols






***********::: ::*.*********:**::*:*:*************



SGD_Scer_PMR1/YGL167C   251   GIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGM   300
MIT_Smik_c735_7219   251   GIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGM   300
MIT_Spar_c469_7837   251   GIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGM   300
MIT_Suva_c403_8364   251   GIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLMSFIVIGM   300
WashU_Sbay_Contig674.36   251   GIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLMSFIVIGM   300
WashU_Scas_Contig707.48   251   GIVVGIGKNTSFGAIFEMLSNIEKPKTPLQNAMDKLGKDLSLFSFIVIGL   300
Symbols






***** *.******:***:.********** :**********.******:



SGD_Scer_PMR1/YGL167C   301   ICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRK   350
MIT_Smik_c735_7219   301   ICLVGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRK   350
MIT_Spar_c469_7837   301   ICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRK   350
MIT_Suva_c403_8364   301   ICLVGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRK   350
WashU_Sbay_Contig674.36   301   ICLVGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRK   350
WashU_Scas_Contig707.48   301   ICLVGILQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRK   350
Symbols






*****::*******************************************



SGD_Scer_PMR1/YGL167C   351   AIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLS   400
MIT_Smik_c735_7219   351   AIVRRLPSVETLGSVNVICSDKTGTLTSNHMTISKLWCLDSMSNKLNVLS   400
MIT_Spar_c469_7837   351   AIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLS   400
MIT_Suva_c403_8364   351   AIVRRLPSVETLGSVNVICSDKTGTLTSNHMTISKLWCLDSMSNKLNVLS   400
WashU_Sbay_Contig674.36   351   AIVRRLPSVETLGSVNVICSDKTGTLTSNHMTISKLWCLDSMSNKLNVLS   400
WashU_Scas_Contig707.48   351   AIVRRLPSVETLGSVNVICSDKTGTLTSNHMTASKIWCLDSMANKANVLS   400
Symbols






******************************** **:******:** ****



SGD_Scer_PMR1/YGL167C   401   LDKNKKTKNSNGNLKNYLTEDVRETLTIGNLCNNASFSQEHAIFLGNPTD   450
MIT_Smik_c735_7219   401   LDKNKKAKNSTGILKNYLTEDVKETLIIGNLCNNASFSQEHATFLGNPTD   450
MIT_Spar_c469_7837   401   LDKNKKTKNSNGNLKNYLTEDVRETLTIGNLCNNASFSQEHAIFLGNPTD   450
MIT_Suva_c403_8364   401   LDKNKKTKN---SLKNYLTEDVRETLTIGNLCNNASFSQEHASFLGNPTD   447
WashU_Sbay_Contig674.36   401   LDKNKKTKN---SLKNYLTEDVRETLTIGNLCNNASFSQEHASFLGNPTD   447
WashU_Scas_Contig707.48   401   LEKSK-----SGSLKNYLTEDVKSTLTIGNICNNASFSQEHGKYLGNPTD   445
Symbols






*:*.* *********:.** ***:**********. :******



SGD_Scer_PMR1/YGL167C   451   VALLEQLANFEMPDIRNTVQKVQELPFNSKRKLMATKILNPVDNKCTVYV   500
MIT_Smik_c735_7219   451   VALLEQLGNFEMSDIRNTVQKVQELPFNSKRKLMATKIFNPVDNKCTVYV   500
MIT_Spar_c469_7837   451   VALLEQLANFEMPDIRNTVQKVQELPFNSKRKLMATKILNPADNKCTVYV   500
MIT_Suva_c403_8364   448   VALLELLTSYDMPDLRNTVQKVQELPFNSRRKFMATKILNPADNKCTVYV   497
WashU_Sbay_Contig674.36   448   VALLELLTSYDMPDLRNTVQKVQELPFNSRRKFMATKILNPADNKCTVYV   497
WashU_Scas_Contig707.48   446   IALLEQLSKFDLSDIRPTFKKVQEIPFNSKRKFMAVKIVN-SEGKYSLCV   494
Symbols






:**** * .:::.*:* *.:****:****:**:**.**.* :.* :: *



SGD_Scer_PMR1/YGL167C   501   KGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMASEGLRVFGF   550
MIT_Smik_c735_7219   501   KGAFEKILSCSTSYLKSKGKRTEKLTEAQMDTINECANSMASEGLRVLGF   550
MIT_Spar_c469_7837   501   KGAFERILECSTSYLKSKGKKTEKLTEAQKDTINECANSMASEGLRVLGF   550
MIT_Suva_c403_8364   498   KGAFEKILECSTSHLKSKGKKTEKLTETQKDTIIECANSMASEGLRVLGF   547
WashU_Sbay_Contig674.36   498   KGAFEKILECSTSHLKSKGKKTEKLTETQKDTIIECANSMASEGLRVLGF   547
WashU_Scas_Contig707.48   495   KGAFEKVLSQCSHYLNQKGK-TEKLTQGQRDVIIETANSLASEGLRMLAF   543
Symbols






*****::*. .: :*:.*** *****: * .* * ***:******::.*



SGD_Scer_PMR1/YGL167C   551   AKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHI   600
MIT_Smik_c735_7219   551   AKLNLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHI   600
MIT_Spar_c469_7837   551   AKLSLSDSSTPLTEDLINDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHI   600
MIT_Suva_c403_8364   548   AKLILSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHI   597
WashU_Sbay_Contig674.36   548   AKLILSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHI   597
WashU_Scas_Contig707.48   544   AKTTLPDSPTLLTEESVGDLIFTGLIGMNDPPRPTVKPAIEQLLQGGVHI   593
Symbols






** *.**.* ***: : ** *************.** ************



SGD_Scer_PMR1/YGL167C   601   IMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHV   650
MIT_Smik_c735_7219   601   IMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLDKMSDDQLANVIDHV   650
MIT_Spar_c469_7837   601   IMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHV   650
MIT_Suva_c403_8364   598   IMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLEKMSDDQLANVIDHV   647
WashU_Sbay_Contig674.36   598   IMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLEKMSDDQLANVIDHV   647
WashU_Scas_Contig707.48   594   IMITGDSENTAVNIARQIGIPVLDPKLSVLSGDKLNEMSDDQLANVIDHV   643
Symbols






***************:******:************::*************



SGD_Scer_PMR1/YGL167C   651   NIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRI   700
MIT_Smik_c735_7219   651   NIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRI   700
MIT_Spar_c469_7837   651   NIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRI   700
MIT_Suva_c403_8364   648   NIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGISMGRI   697
WashU_Sbay_Contig674.36   648   NIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGISMGRI   697
WashU_Scas_Contig707.48   644   NIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLADIGVSMGRM   693
Symbols






****************************************:***:****:



SGD_Scer_PMR1/YGL167C   701   GTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAAL   750
MIT_Smik_c735_7219   701   GTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAAL   750
MIT_Spar_c469_7837   701   GTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAAL   750
MIT_Suva_c403_8364   698   GTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAAL   747
WashU_Sbay_Contig674.36   698   GTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAAL   747
WashU_Scas_Contig707.48   694   GTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAAL   743
Symbols






**************************************************



SGD_Scer_PMR1/YGL167C   751   SLVALSTAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPR   800
MIT_Smik_c735_7219   751   SLVALSTAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPR   800
MIT_Spar_c469_7837   751   SLVALSTAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPR   800
MIT_Suva_c403_8364   748   SLVALSTAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPR   797
WashU_Sbay_Contig674.36   748   SLVALSTAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPR   797
WashU_Scas_Contig707.48   744   SLIALSTAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPR   793
Symbols






**:***********************************************



SGD_Scer_PMR1/YGL167C   801   KRTDKILTHDVMKRLLTTAACIIVGTVYIFVKEMAEDGKVTARDTTMTFT   850
MIT_Smik_c735_7219   801   KRTDKILTHDVMKRLLTTAACIIIGTVYIFVKEMAEDGKVTARDTTMTFT   850
MIT_Spar_c469_7837   801   KRTDKILTHDVMKRLLTTAACIIVGTVYIFVKEMAEDGKVTARDTTMTFT   850
MIT_Suva_c403_8364   798   KRTDKILTHEVMKRLITTATCIIIGTVYIFVKEMAEDGKVTARDTTMTFT   847
WashU_Sbay_Contig674.36   798   KRTDKILTHEVMKRLITTATCIIIGTVYIFVKEMAEDGKVTARDTTMTFT   847
WashU_Scas_Contig707.48   794   KRSEKILTSQVLKRLLGTAACIILGTVYVFIKEMAEDGEVTARDTTMTFT   843
Symbols






**::**** :*:***: **:***:****:*:*******:***********



SGD_Scer_PMR1/YGL167C   851   CFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIPF   900
MIT_Smik_c735_7219   851   CFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIPF   900
MIT_Spar_c469_7837   851   CFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIPF   900
MIT_Suva_c403_8364   848   CFVFFDMFNALACRHNTKSIFEVGFFTNKMFNYAVGLSLLGQMCAIYIPF   897
WashU_Sbay_Contig674.36   848   CFVFFDMFNALACRHNTKSIFEVGFFTNKMFNYAVGLSLLGQMCAIYIPF   897
WashU_Scas_Contig707.48   844   CFVFFDMFNALACRHSTKSIFEVGFFANKMFNLAVGLSLLGQMCAIYIPF   893
Symbols






***************.******:***:***** *****************



SGD_Scer_PMR1/YGL167C   901   FQSIFKTEKLGISDILLLLLISSSVFIVDELRKLWTRKKNEEDSTYFSNV   950
MIT_Smik_c735_7219   901   FQSIFKTERLSVSDILLLLLISSTVFIVDELRKLWARKMNERDPTYYSNV   950
MIT_Spar_c469_7837   901   FQSIFKTEKLGISDILLLLLISSTVFIVDELRKLWTRKMNERDSTYYSNV   950
MIT_Suva_c403_8364   898   FQSIFKTESLRVSDLLLLLLISSSVFVVDELRKLWMRKMNERDPTYYSNV   947
WashU_Sbay_Contig674.36   898   FQSIFKTESLRVSDLLLLLLISSSVFVVDELRKLWMRKMNERDPTYYSNV   947
WashU_Scas_Contig707.48   894   FQSVFKTESLSFMDLIFLLVISSSVFVFDELRKWWVKRTTSTIDAYYDIV   943
Symbols






***:**** * . *:::**:***:**:.***** * :: .. :*:. *



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_PMR1/YGL167C:

SGD_Scer_PMR1/YGL167C  Length: 951  Mon Nov  7 15:24:50 2016  Type: P  Check: 9001  ..

       1  MSDNPFNASL LDEDSNRERE ILDATAEALS KPSPSLEYCT LSVDEALEKL

      51  DTDKNGGLRS SNEANNRRSL YGPNEITVED DESLFKKFLS NFIEDRMILL

     101  LIGSAVVSLF MGNIDDAVSI TLAIFIVVTV GFVQEYRSEK SLEALNKLVP

     151  AECHLMRCGQ ESHVLASTLV PGDLVHFRIG DRIPADIRII EAIDLSIDES

     201  NLTGENEPVH KTSQTIEKSS FNDQPNSIVP ISERSCIAYM GTLVKEGHGK

     251  GIVVGTGTNT SFGAVFEMMN NIEKPKTPLQ LTMDKLGKDL SLVSFIVIGM

     301  ICLVGIIQGR SWLEMFQISV SLAVAAIPEG LPIIVTVTLA LGVLRMAKRK

     351  AIVRRLPSVE TLGSVNVICS DKTGTLTSNH MTVSKLWCLD SMSNKLNVLS

     401  LDKNKKTKNS NGNLKNYLTE DVRETLTIGN LCNNASFSQE HAIFLGNPTD

     451  VALLEQLANF EMPDIRNTVQ KVQELPFNSK RKLMATKILN PVDNKCTVYV

     501  KGAFERILEY STSYLKSKGK KTEKLTEAQK ATINECANSM ASEGLRVFGF

     551  AKLTLSDSST PLTEDLIKDL TFTGLIGMND PPRPNVKFAI EQLLQGGVHI

     601  IMITGDSENT AVNIAKQIGI PVIDPKLSVL SGDKLDEMSD DQLANVIDHV

     651  NIFARATPEH KLNIVRALRK RGDVVAMTGD GVNDAPALKL SDIGVSMGRI

     701  GTDVAKEASD MVLTDDDFST ILTAIEEGKG IFNNIQNFLT FQLSTSVAAL

     751  SLVALSTAFK LPNPLNAMQI LWINILMDGP PAQSLGVEPV DHEVMKKPPR

     801  KRTDKILTHD VMKRLLTTAA CIIVGTVYIF VKEMAEDGKV TARDTTMTFT

     851  CFVFFDMFNA LACRHNTKSI FEIGFFTNKM FNYAVGLSLL GQMCAIYIPF

     901  FQSIFKTEKL GISDILLLLL ISSSVFIVDE LRKLWTRKKN EEDSTYFSNV

     951  *

Protein Sequence for MIT_Smik_c735_7219:

MIT_Smik_c735_7219  Length: 951  Mon Nov  7 15:24:50 2016  Type: P  Check: 1671  ..

       1  MSDNPFNASL LDEDSNRERE ILDATAEALS KPSPSLEYCT LSVEETLERL

      51  ETDKNSGLRS SNEANNRRSL YGPNEITVED DENIFKKFLF NFIEDRMILL

     101  LIGSAVVSLF MGNIDDAVSI TLAIFIVVTV GFVQEYRSEK SLEALNKLVP

     151  AECHLMRCGQ ESHVLASTLV PGDLVHFRIG DRIPADLRII EATDLSIDES

     201  NLTGENEPVH KSSQTIEKSS FNDQPNSIVP IAERSCIAYM GTLVKEGHGK

     251  GIVVGTGTNT SFGAVFEMMN NIEKPKTPLQ LTMDKLGKDL SLVSFIVIGM

     301  ICLVGVIQGR SWLEMFQISV SLAVAAIPEG LPIIVTVTLA LGVLRMAKRK

     351  AIVRRLPSVE TLGSVNVICS DKTGTLTSNH MTISKLWCLD SMSNKLNVLS

     401  LDKNKKAKNS TGILKNYLTE DVKETLIIGN LCNNASFSQE HATFLGNPTD

     451  VALLEQLGNF EMSDIRNTVQ KVQELPFNSK RKLMATKIFN PVDNKCTVYV

     501  KGAFEKILSC STSYLKSKGK RTEKLTEAQM DTINECANSM ASEGLRVLGF

     551  AKLNLSDSST PLTEDLIKDL TFTGLIGMND PPRPNVKFAI EQLLQGGVHI

     601  IMITGDSENT AVNIARQIGI PVIDPKLSVL SGDKLDKMSD DQLANVIDHV

     651  NIFARATPEH KLNIVRALRK RGDVVAMTGD GVNDAPALKL SDIGVSMGRI

     701  GTDVAKEASD MVLTDDDFST ILTAIEEGKG IFNNIQNFLT FQLSTSVAAL

     751  SLVALSTAFK LPNPLNAMQI LWINILMDGP PAQSLGVEPV DHEVMKKPPR

     801  KRTDKILTHD VMKRLLTTAA CIIIGTVYIF VKEMAEDGKV TARDTTMTFT

     851  CFVFFDMFNA LACRHNTKSI FEIGFFTNKM FNYAVGLSLL GQMCAIYIPF

     901  FQSIFKTERL SVSDILLLLL ISSTVFIVDE LRKLWARKMN ERDPTYYSNV

     951  *

Protein Sequence for MIT_Spar_c469_7837:

MIT_Spar_c469_7837  Length: 951  Mon Nov  7 15:24:50 2016  Type: P  Check: 9810  ..

       1  MSDNPFNASL LDEDSNRERE ILDATAEALS KPSPSLEYCT LSVDETLEKL

      51  DTDKNGGLRS SNEANNRRSL YGPNEITVED DESLFKKFLS NFIEDRMILL

     101  LIGSAVVSLF MGNIDDAVSI TLAIFIVVTV GFVQEYRSEK SLEALNKLVP

     151  AECHLMRCGQ ESHVLASTLV PGDLVHFRIG DRIPADLRII EAIDLSIDES

     201  NLTGENEPVH KTSQTIEKSS FNDQPNSIVP ISERSCIAYM GTLVKEGHGK

     251  GIVVGTGTNT SFGAVFEMMN NIEKPKTPLQ LTMDKLGKDL SLVSFIVIGM

     301  ICLVGIIQGR SWLEMFQISV SLAVAAIPEG LPIIVTVTLA LGVLRMAKRK

     351  AIVRRLPSVE TLGSVNVICS DKTGTLTSNH MTVSKLWCLD SMSNKLNVLS

     401  LDKNKKTKNS NGNLKNYLTE DVRETLTIGN LCNNASFSQE HAIFLGNPTD

     451  VALLEQLANF EMPDIRNTVQ KVQELPFNSK RKLMATKILN PADNKCTVYV

     501  KGAFERILEC STSYLKSKGK KTEKLTEAQK DTINECANSM ASEGLRVLGF

     551  AKLSLSDSST PLTEDLINDL TFTGLIGMND PPRPNVKFAI EQLLQGGVHI

     601  IMITGDSENT AVNIARQIGI PVIDPKLSVL SGDKLDEMSD DQLANVIDHV

     651  NIFARATPEH KLNIVRALRK RGDVVAMTGD GVNDAPALKL SDIGVSMGRI

     701  GTDVAKEASD MVLTDDDFST ILTAIEEGKG IFNNIQNFLT FQLSTSVAAL

     751  SLVALSTAFK LPNPLNAMQI LWINILMDGP PAQSLGVEPV DHEVMKKPPR

     801  KRTDKILTHD VMKRLLTTAA CIIVGTVYIF VKEMAEDGKV TARDTTMTFT

     851  CFVFFDMFNA LACRHNTKSI FEIGFFTNKM FNYAVGLSLL GQMCAIYIPF

     901  FQSIFKTEKL GISDILLLLL ISSTVFIVDE LRKLWTRKMN ERDSTYYSNV

     951  *

Protein Sequence for MIT_Suva_c403_8364:

MIT_Suva_c403_8364  Length: 948  Mon Nov  7 15:24:50 2016  Type: P  Check: 4812  ..

       1  MSDNPFNGSL LDEDSNRERD IIDATTEALW KPNPSLEYGT LSVEETLEQL

      51  QTDENNGLRS SSEATNRRAL HGPNEITVED DESLFKKFLS NFIEDRLILL

     101  LIGSAVVSFC MGNTDDAISI TLAIFIVVTV GFVQEYRSEK SLEALNKLVP

     151  AECHLMRCGQ ESHVLASTLV PGDLVHFRIG DRIPADLRII EATDLTIDES

     201  NLTGENEPVH KTSETIEKSS FNDQPNSIVP IAERTCIAYM GTLVKEGHGK

     251  GIVVGTGTNT SFGAVFEMMN NIEKPKTPLQ LTMDKLGKDL SLMSFIVIGM

     301  ICLVGVIQGR SWLEMFQISV SLAVAAIPEG LPIIVTVTLA LGVLRMAKRK

     351  AIVRRLPSVE TLGSVNVICS DKTGTLTSNH MTISKLWCLD SMSNKLNVLS

     401  LDKNKKTKNS LKNYLTEDVR ETLTIGNLCN NASFSQEHAS FLGNPTDVAL

     451  LELLTSYDMP DLRNTVQKVQ ELPFNSRRKF MATKILNPAD NKCTVYVKGA

     501  FEKILECSTS HLKSKGKKTE KLTETQKDTI IECANSMASE GLRVLGFAKL

     551  ILSDSSTPLT EDLIKDLTFT GLIGMNDPPR PNVKFAIEQL LQGGVHIIMI

     601  TGDSENTAVN IARQIGIPVI DPKLSVLSGD KLEKMSDDQL ANVIDHVNIF

     651  ARATPEHKLN IVRALRKRGD VVAMTGDGVN DAPALKLSDI GISMGRIGTD

     701  VAKEASDMVL TDDDFSTILT AIEEGKGIFN NIQNFLTFQL STSVAALSLV

     751  ALSTAFKLPN PLNAMQILWI NILMDGPPAQ SLGVEPVDHE VMKKPPRKRT

     801  DKILTHEVMK RLITTATCII IGTVYIFVKE MAEDGKVTAR DTTMTFTCFV

     851  FFDMFNALAC RHNTKSIFEV GFFTNKMFNY AVGLSLLGQM CAIYIPFFQS

     901  IFKTESLRVS DLLLLLLISS SVFVVDELRK LWMRKMNERD PTYYSNV*


Protein Sequence for WashU_Sbay_Contig674.36:

WashU_Sbay_Contig674.36  Length: 948  Mon Nov  7 15:24:50 2016  Type: P  Check: 4488  ..

       1  MSDNPFNASL LDEDSNRERD IIDATTEALS KPNPSLEYCT LSVEETLEQL

      51  QTDENNGLRS SSEATNRRAL HGPNEITVED DESLFKKFLS NFIEDRLILL

     101  LIGSAVVSFC MGNTDDAISI TLAIFIVVTV GFVQEYRSEK SLEALNKLVP

     151  AECHLMRCGQ ESHVLASTLV PGDLVHFRIG DRIPADLRII EATDLTIDES

     201  NLTGENEPVH KTSETIEKSS FNDQPNSIVP IAERTCIAYM GTLVKEGHGK

     251  GIVVGTGTNT SFGAVFEMMN NIEKPKTPLQ LTMDKLGKDL SLMSFIVIGM

     301  ICLVGVIQGR SWLEMFQISV SLAVAAIPEG LPIIVTVTLA LGVLRMAKRK

     351  AIVRRLPSVE TLGSVNVICS DKTGTLTSNH MTISKLWCLD SMSNKLNVLS

     401  LDKNKKTKNS LKNYLTEDVR ETLTIGNLCN NASFSQEHAS FLGNPTDVAL

     451  LELLTSYDMP DLRNTVQKVQ ELPFNSRRKF MATKILNPAD NKCTVYVKGA

     501  FEKILECSTS HLKSKGKKTE KLTETQKDTI IECANSMASE GLRVLGFAKL

     551  ILSDSSTPLT EDLIKDLTFT GLIGMNDPPR PNVKFAIEQL LQGGVHIIMI

     601  TGDSENTAVN IARQIGIPVI DPKLSVLSGD KLEKMSDDQL ANVIDHVNIF

     651  ARATPEHKLN IVRALRKRGD VVAMTGDGVN DAPALKLSDI GISMGRIGTD

     701  VAKEASDMVL TDDDFSTILT AIEEGKGIFN NIQNFLTFQL STSVAALSLV

     751  ALSTAFKLPN PLNAMQILWI NILMDGPPAQ SLGVEPVDHE VMKKPPRKRT

     801  DKILTHEVMK RLITTATCII IGTVYIFVKE MAEDGKVTAR DTTMTFTCFV

     851  FFDMFNALAC RHNTKSIFEV GFFTNKMFNY AVGLSLLGQM CAIYIPFFQS

     901  IFKTESLRVS DLLLLLLISS SVFVVDELRK LWMRKMNERD PTYYSNV*


Protein Sequence for WashU_Scas_Contig707.48:

WashU_Scas_Contig707.48  Length: 944  Mon Nov  7 15:24:50 2016  Type: P  Check: 5723  ..

       1  MSANPFDAPI ADERSIEERE LLEVAKEALS RPNASLEYCT MSVDETLRKL

      51  ETDPKSGLGS IAEASRRKLV YGANEIVIEE DESLWKKFLS SFVEDRLILL

     101  LIGSAVVSFI MGNIDDAVSI TLAIVIVVSV GFVQEYRSEK SLEALNKLVP

     151  AECHLIRCGQ ESHVLASGLV PGDLVHFKIG DRIPADLRII EAVDLSIDES

     201  NLTGENEPVH KSAKEVNKDS FNDQPNSIIP ISDRTCVAYM GTLVKEGHGK

     251  GIVVGIGKNT SFGAIFEMLS NIEKPKTPLQ NAMDKLGKDL SLFSFIVIGL

     301  ICLVGILQGR SWLEMFQISV SLAVAAIPEG LPIIVTVTLA LGVLRMAKRK

     351  AIVRRLPSVE TLGSVNVICS DKTGTLTSNH MTASKIWCLD SMANKANVLS

     401  LEKSKSGSLK NYLTEDVKST LTIGNICNNA SFSQEHGKYL GNPTDIALLE

     451  QLSKFDLSDI RPTFKKVQEI PFNSKRKFMA VKIVNSEGKY SLCVKGAFEK

     501  VLSQCSHYLN QKGKTEKLTQ GQRDVIIETA NSLASEGLRM LAFAKTTLPD

     551  SPTLLTEESV GDLIFTGLIG MNDPPRPTVK PAIEQLLQGG VHIIMITGDS

     601  ENTAVNIARQ IGIPVLDPKL SVLSGDKLNE MSDDQLANVI DHVNIFARAT

     651  PEHKLNIVRA LRKRGDVVAM TGDGVNDAPA LKLADIGVSM GRMGTDVAKE

     701  ASDMVLTDDD FSTILTAIEE GKGIFNNIQN FLTFQLSTSV AALSLIALST

     751  AFKLPNPLNA MQILWINILM DGPPAQSLGV EPVDHEVMKK PPRKRSEKIL

     801  TSQVLKRLLG TAACIILGTV YVFIKEMAED GEVTARDTTM TFTCFVFFDM

     851  FNALACRHST KSIFEVGFFA NKMFNLAVGL SLLGQMCAIY IPFFQSVFKT

     901  ESLSFMDLIF LLVISSSVFV FDELRKWWVK RTTSTIDAYY DIV*