Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YGL045W and Homologs


Choose two or more sequences for alignment:
Pick a sequence type:
Best Hits & Orthologs"Other" Hits

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_RIM8/YGL045W   1   ------MSLLRLWNKESRAPSKIKSHG-IVGSYGNSMLAHNNVKQFRIDI   43
WashU_Sbay_Contig576.6   1   ------MSLLRLWSKEPKSSSKIKGHG-IVGSYSNSMLAHNNVRQFRIDI   43
WashU_Scas_Contig621.8   1   ------MAFLDILKKSSTDKKRIKSSS----FAHSHSYGYSTVTQFFIKI   40
WashU_Sklu_Contig1879.2   1   MGFLGKFKKARSPTDNPCTVTSNSSLVSNNSNARFRLSSPNDIQEFYLDM   50
WashU_Skud_Contig1607.4   1   ------MSLLRLWNKEPKASSKKKSHGSIVGSYGNSMLAHNNVKQFRMDI   44
Symbols






: .... . .. . . : :* :.:



SGD_Scer_RIM8/YGL045W   44   DEPHRVWKPNESITGEAVIDIKRDITNVAIKLSLVCEVRVKTGNS-PTSK   92
WashU_Sbay_Contig576.6   44   SEPHSVWKPDECITGETVIDIKKDITNVAIKISLVCEVRVKTGNS-PTSK   92
WashU_Scas_Contig621.8   41   DEPHRIWKPDEYISGETTLEIRKDVTNIAVELSLISEIKVKVKNTSPTTR   90
WashU_Sklu_Contig1879.2   51   DEPHKVWKPNEYITGESVLILKKDMTNIAIKLSLIGEVRVKTGTG-ATSR   99
WashU_Skud_Contig1607.4   45   NELHRVWKPNENIIGEAVIDIKRDITNVAIKLSLVCEVRVKTGNS-PTSK   93
Symbols






.* * :***:* * **:.: :::*:**:*:::**: *::**. . .*::



SGD_Scer_RIM8/YGL045W   93   NKRIEKTLEKSTFLYGQDYVKTAFSAKEKKPHVDKTTILNGLSKGEHRFP   142
WashU_Sbay_Contig576.6   93   NKRVEKILEKSTFLYGQEHIKPAPSTVEKKPPIDKSTVLNGLSKGEHRFP   142
WashU_Scas_Contig621.8   91   TKRVERLIERSTFLYGNNDIDSNKIG---------SSPVNGLTKGQHKFP   131
WashU_Sklu_Contig1879.2   100   TKISEKLFDKHTFIYGGEDNDQ------------EQQVVNGLTKGEHRFP   137
WashU_Skud_Contig1607.4   94   NKRIEKVLEKSTFLYGQDYVKADSSAKEKKPSTDKSTVFNGLSKGEHRFP   143
Symbols






.* *: ::: **:** : . .***:**:*:**



SGD_Scer_RIM8/YGL045W   143   FRIRIPRGRGMLSSIKFERGSITYFLSCTLESLNNINGLKKPEARCEREF   192
WashU_Sbay_Contig576.6   143   FRIKIPRGKGMLSSIKFERGSITYFLICTLESLNNVNALKKPEARCEREF   192
WashU_Scas_Contig621.8   132   FRIKIPHGKKIFSSIKFEKGSIDYFLKCSFVTIG-TKQNDKPIATCEQGF   180
WashU_Sklu_Contig1879.2   138   FRMKIPSSK-VYTSIKFERGSISYHVECSLGHIG--TAADEEIAKCQKKF   184
WashU_Skud_Contig1607.4   144   FRIKIPRGKGMLSSIKFERGSITYFLTCALESLDKINALKKPEAKCEHEF   193
Symbols






**::** .: : :*****:*** *.: *:: :. . .: * *:: *



SGD_Scer_RIM8/YGL045W   193   AVIVPLDVSRLPKPKTKTVVLQSASMVQNKKNKST---------EDESSS   233
WashU_Sbay_Contig576.6   193   SVIVPLDVSRLPKQKTKTVVLQSASMVQNKKGKSS---------EDASSS   233
WashU_Scas_Contig621.8   181   TVIVPLDVSKLPQPRTKRVVLQSYSMLSAVNSSTSNSANKHLSGEDVSSS   230
WashU_Sklu_Contig1879.2   185   SILVPVDVGTLPKPNTKSVVLQSPLSLKHSRVNLSE--------QDTSSS   226
WashU_Skud_Contig1607.4   194   SVVVPLDVSRLPKPKTKTVVLQSASMVQNRRGKST---------EDGSSS   234
Symbols






:::**:**. **: .** ***** :. . . : :* ***



SGD_Scer_RIM8/YGL045W   234   YTQLTQKSTTSNSS---------SSSVNSKTSPLPNKTVTISVDIPQAGF   274
WashU_Sbay_Contig576.6   234   YTQLTHKSNNSNSS---------GSTVNSKTSSPPVKTVTISVDIPHAGF   274
WashU_Scas_Contig621.8   231   FTKFTRQSATSRNSKISKSSSGSSSSTNNGTPVAQDKTVSVSVDLPQSGF   280
WashU_Sklu_Contig1879.2   227   LTKKTNNSTGSNSS---------------LTTNSSFKTVSISVDLPESGF   261
WashU_Skud_Contig1607.4   235   YTQLTQKSNASNSS---------GSSVNSKTSPLPNKTVTISVDIPQAGF   275
Symbols






*: *.:* *..* *. ***::***:*.:**



SGD_Scer_RIM8/YGL045W   275   MIGEIIPIDVKIDHYKPFYAPAGLTTTLVRICRVGGAGKDDPMETFRKDI   324
WashU_Sbay_Contig576.6   275   VIGETIPIDVKIEHYKPFYHPAGLTTTLVRICRVGGAGKDDPMETFRKDI   324
WashU_Scas_Contig621.8   281   VVGELIPIQISVKHYKEFHHPAGLIVTLVRICRVG--NKDEAMETFRKDI   328
WashU_Sklu_Contig1879.2   262   VIGEKIPIKINMQHYKEYAHPAGLIATLVRICRVG-DGTKDIIETFRKDI   310
WashU_Skud_Contig1607.4   276   MIGEIVPIDVRIDHYKPFYAPAGLTTTLVRICRVGGAGKDDPMETFRKDI   325
Symbols






::** :**.: :.*** : **** .********* ...: :*******



SGD_Scer_RIM8/YGL045W   325   CQSISPIYINPETLQFQSRVYLKVPLDAFSTLTTVGKFFSFQYYIEVMVN   374
WashU_Sbay_Contig576.6   325   CQSISPIYINPETLQFQPRIHLKVPLDAFSTLTSVGKFFSFQYYIEVMVN   374
WashU_Scas_Contig621.8   329   CQTILPLYIDPQMLESHSTAFLKVPLDTFSTFTSFNNFFSFQYYVEVMVN   378
WashU_Sklu_Contig1879.2   311   CQTVAPLYLDFETHECSITVYLKVPLDAFPTLTLPSKYFTFQYYVEVLVN   360
WashU_Skud_Contig1607.4   326   CQSISPIYINPETLQFQSRVYLKVPLDAFSTLTTVNKFFSFQYYIEVMVN   375
Symbols






**:: *:*:: : : .******:*.*:* .::*:****:**:**



SGD_Scer_RIM8/YGL045W   375   LSKKNVVYTESNRIIG------------TPIGEQNGLGVENNINRIQRKM   412
WashU_Sbay_Contig576.6   375   LSKKNVVYTESNRIVG------------TPVEEQNGSGVEHNINRIQRKM   412
WashU_Scas_Contig621.8   379   LSRKNIIYTESNRIIGGGDEGYSQNSDNLDVSNKVTTGMEDNLNNIHRKV   428
WashU_Sklu_Contig1879.2   361   LSRKNIVYTESNRILGGG---------NTNDSSYSKTSAEGKFSMLQRRL   401
WashU_Skud_Contig1607.4   376   LSKKNVVYTESNRIIG------------TPIEEQNGLGVENNINRIQRKM   413
Symbols






**:**::*******:* . . * ::. ::*::



SGD_Scer_RIM8/YGL045W   413   LRMVNPETLENDS-EGYESSIFFKDMVNVEKLKRLRNVTGMSIETVIGTT   461
WashU_Sbay_Contig576.6   413   LRMVNPETLENDS-EGYESSIFFKDMVNVEKLKRLRNVTGMSIETVIGTT   461
WashU_Scas_Contig621.8   429   LKLVSTSHVSTDQKETMESNIVYQDMVNVEKLKRLRNVTGMSIEIIVGTT   478
WashU_Sklu_Contig1879.2   402   RGSNNGEINDDDE-----SSIFFQDLVNVDKLKRLRNVTGMSIEVVIGTN   446
WashU_Skud_Contig1607.4   414   LRMVNPETLENDS-EGYESSIFFKDMVNVEKLKRLRNVTGMSIETVIGTT   462
Symbols






. . . *. *.*.::*:***:************** ::**.



SGD_Scer_RIM8/YGL045W   462   RSEQQQ-------SDASIPSQS-----------------SITAPQNSPSN   487
WashU_Sbay_Contig576.6   462   RSEQQQQQQQQQQYSTNLLRQP-----------------ASTTAQNLVPD   494
WashU_Scas_Contig621.8   479   RLEEVEAAKESDDVERTQQSQTNIPYNEMNY------VKRTPSPPRVGQL   522
WashU_Sklu_Contig1879.2   447   RLQKDEDLDKEEENAQEGNSSPLPEIYDQLLNSYGGQLNTKHNIQKMENV   496
WashU_Skud_Contig1607.4   463   RSEVQQ-------YETNFPRET-----------------LTTAPQSPALD   488
Symbols






* : : ..



SGD_Scer_RIM8/YGL045W   488   LRDWLAPLNAYDSDDVPVPKYSPNDKVSVPSEDKQELEQKRLQQLESDPP   537
WashU_Sbay_Contig576.6   495   LRDWLAPLNAYECDDVPVPKYSPNDRVNVSSEDKQELEQRRLQQLESDPP   544
WashU_Scas_Contig621.8   523   PTPNMNEWLSSSIDYQQVPEYTPNENMTVS-EDKQEFEKERLLAMESEPE   571
WashU_Sklu_Contig1879.2   497   LYPSEPVLDYDNVMVPPVPRYTPN-AEYIPIEDKNELEQMRLRQLESDPP   545
WashU_Skud_Contig1607.4   489   LRDWLAPLNAYAGDGVPVPEYSPNDKVNVPSEDKQELEQKRLKQLESDPP   538
Symbols






**.*:** :. ***:*:*: ** :**:*



SGD_Scer_RIM8/YGL045W   538   PCDDY   542
WashU_Sbay_Contig576.6   545   PCDDY   549
WashU_Scas_Contig621.8   572   EY---   573
WashU_Sklu_Contig1879.2   546   PAEDY   550
WashU_Skud_Contig1607.4   539   PCDDY   543
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_RIM8/YGL045W:

SGD_Scer_RIM8/YGL045W  Length: 543  Mon Nov  7 15:22:07 2016  Type: P  Check: 5965  ..

       1  MSLLRLWNKE SRAPSKIKSH GIVGSYGNSM LAHNNVKQFR IDIDEPHRVW

      51  KPNESITGEA VIDIKRDITN VAIKLSLVCE VRVKTGNSPT SKNKRIEKTL

     101  EKSTFLYGQD YVKTAFSAKE KKPHVDKTTI LNGLSKGEHR FPFRIRIPRG

     151  RGMLSSIKFE RGSITYFLSC TLESLNNING LKKPEARCER EFAVIVPLDV

     201  SRLPKPKTKT VVLQSASMVQ NKKNKSTEDE SSSYTQLTQK STTSNSSSSS

     251  VNSKTSPLPN KTVTISVDIP QAGFMIGEII PIDVKIDHYK PFYAPAGLTT

     301  TLVRICRVGG AGKDDPMETF RKDICQSISP IYINPETLQF QSRVYLKVPL

     351  DAFSTLTTVG KFFSFQYYIE VMVNLSKKNV VYTESNRIIG TPIGEQNGLG

     401  VENNINRIQR KMLRMVNPET LENDSEGYES SIFFKDMVNV EKLKRLRNVT

     451  GMSIETVIGT TRSEQQQSDA SIPSQSSITA PQNSPSNLRD WLAPLNAYDS

     501  DDVPVPKYSP NDKVSVPSED KQELEQKRLQ QLESDPPPCD DY*


Protein Sequence for WashU_Sbay_Contig576.6:

WashU_Sbay_Contig576.6  Length: 550  Mon Nov  7 15:22:07 2016  Type: P  Check: 2752  ..

       1  MSLLRLWSKE PKSSSKIKGH GIVGSYSNSM LAHNNVRQFR IDISEPHSVW

      51  KPDECITGET VIDIKKDITN VAIKISLVCE VRVKTGNSPT SKNKRVEKIL

     101  EKSTFLYGQE HIKPAPSTVE KKPPIDKSTV LNGLSKGEHR FPFRIKIPRG

     151  KGMLSSIKFE RGSITYFLIC TLESLNNVNA LKKPEARCER EFSVIVPLDV

     201  SRLPKQKTKT VVLQSASMVQ NKKGKSSEDA SSSYTQLTHK SNNSNSSGST

     251  VNSKTSSPPV KTVTISVDIP HAGFVIGETI PIDVKIEHYK PFYHPAGLTT

     301  TLVRICRVGG AGKDDPMETF RKDICQSISP IYINPETLQF QPRIHLKVPL

     351  DAFSTLTSVG KFFSFQYYIE VMVNLSKKNV VYTESNRIVG TPVEEQNGSG

     401  VEHNINRIQR KMLRMVNPET LENDSEGYES SIFFKDMVNV EKLKRLRNVT

     451  GMSIETVIGT TRSEQQQQQQ QQQQYSTNLL RQPASTTAQN LVPDLRDWLA

     501  PLNAYECDDV PVPKYSPNDR VNVSSEDKQE LEQRRLQQLE SDPPPCDDY*


Protein Sequence for WashU_Scas_Contig621.8:

WashU_Scas_Contig621.8  Length: 574  Mon Nov  7 15:22:07 2016  Type: P  Check: 9422  ..

       1  MAFLDILKKS STDKKRIKSS SFAHSHSYGY STVTQFFIKI DEPHRIWKPD

      51  EYISGETTLE IRKDVTNIAV ELSLISEIKV KVKNTSPTTR TKRVERLIER

     101  STFLYGNNDI DSNKIGSSPV NGLTKGQHKF PFRIKIPHGK KIFSSIKFEK

     151  GSIDYFLKCS FVTIGTKQND KPIATCEQGF TVIVPLDVSK LPQPRTKRVV

     201  LQSYSMLSAV NSSTSNSANK HLSGEDVSSS FTKFTRQSAT SRNSKISKSS

     251  SGSSSSTNNG TPVAQDKTVS VSVDLPQSGF VVGELIPIQI SVKHYKEFHH

     301  PAGLIVTLVR ICRVGNKDEA METFRKDICQ TILPLYIDPQ MLESHSTAFL

     351  KVPLDTFSTF TSFNNFFSFQ YYVEVMVNLS RKNIIYTESN RIIGGGDEGY

     401  SQNSDNLDVS NKVTTGMEDN LNNIHRKVLK LVSTSHVSTD QKETMESNIV

     451  YQDMVNVEKL KRLRNVTGMS IEIIVGTTRL EEVEAAKESD DVERTQQSQT

     501  NIPYNEMNYV KRTPSPPRVG QLPTPNMNEW LSSSIDYQQV PEYTPNENMT

     551  VSEDKQEFEK ERLLAMESEP EEY*

Protein Sequence for WashU_Sklu_Contig1879.2:

WashU_Sklu_Contig1879.2  Length: 551  Mon Nov  7 15:22:07 2016  Type: P  Check: 3574  ..

       1  MGFLGKFKKA RSPTDNPCTV TSNSSLVSNN SNARFRLSSP NDIQEFYLDM

      51  DEPHKVWKPN EYITGESVLI LKKDMTNIAI KLSLIGEVRV KTGTGATSRT

     101  KISEKLFDKH TFIYGGEDND QEQQVVNGLT KGEHRFPFRM KIPSSKVYTS

     151  IKFERGSISY HVECSLGHIG TAADEEIAKC QKKFSILVPV DVGTLPKPNT

     201  KSVVLQSPLS LKHSRVNLSE QDTSSSLTKK TNNSTGSNSS LTTNSSFKTV

     251  SISVDLPESG FVIGEKIPIK INMQHYKEYA HPAGLIATLV RICRVGDGTK

     301  DIIETFRKDI CQTVAPLYLD FETHECSITV YLKVPLDAFP TLTLPSKYFT

     351  FQYYVEVLVN LSRKNIVYTE SNRILGGGNT NDSSYSKTSA EGKFSMLQRR

     401  LRGSNNGEIN DDDESSIFFQ DLVNVDKLKR LRNVTGMSIE VVIGTNRLQK

     451  DEDLDKEEEN AQEGNSSPLP EIYDQLLNSY GGQLNTKHNI QKMENVLYPS

     501  EPVLDYDNVM VPPVPRYTPN AEYIPIEDKN ELEQMRLRQL ESDPPPAEDY

     551  *

Protein Sequence for WashU_Skud_Contig1607.4:

WashU_Skud_Contig1607.4  Length: 544  Mon Nov  7 15:22:07 2016  Type: P  Check: 6330  ..

       1  MSLLRLWNKE PKASSKKKSH GSIVGSYGNS MLAHNNVKQF RMDINELHRV

      51  WKPNENIIGE AVIDIKRDIT NVAIKLSLVC EVRVKTGNSP TSKNKRIEKV

     101  LEKSTFLYGQ DYVKADSSAK EKKPSTDKST VFNGLSKGEH RFPFRIKIPR

     151  GKGMLSSIKF ERGSITYFLT CALESLDKIN ALKKPEAKCE HEFSVVVPLD

     201  VSRLPKPKTK TVVLQSASMV QNRRGKSTED GSSSYTQLTQ KSNASNSSGS

     251  SVNSKTSPLP NKTVTISVDI PQAGFMIGEI VPIDVRIDHY KPFYAPAGLT

     301  TTLVRICRVG GAGKDDPMET FRKDICQSIS PIYINPETLQ FQSRVYLKVP

     351  LDAFSTLTTV NKFFSFQYYI EVMVNLSKKN VVYTESNRII GTPIEEQNGL

     401  GVENNINRIQ RKMLRMVNPE TLENDSEGYE SSIFFKDMVN VEKLKRLRNV

     451  TGMSIETVIG TTRSEVQQYE TNFPRETLTT APQSPALDLR DWLAPLNAYA

     501  GDGVPVPEYS PNDKVNVPSE DKQELEQKRL KQLESDPPPC DDY*