Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YFL049W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_SWP82/YFL049W   1   MLGEDEGNTVLEKGNNPSVKQGEVGAVFIVPKILIREHERVILKQILQIL   50
MIT_Smik_c514_8110   1   MVYEGDGETTRDERSSSSLKQGDIGVVFIVPKILIREHERVILKQILQIL   50
MIT_Spar_c345_7103   1   MLDDNDGETVHEDRNNSSLEQGEIGAVFIVPKILIREHERVILKQILQIL   50
MIT_Suva_c781_7206   1   -MLGEEVEKAANGEEVSSSQRDEIGATFLVPKLLIKEHERVILKQILQIL   49
WashU_Sbay_Contig629.3   1   -MLGEEVEKAANGEEVSSSQRDEIGATFLVPKLLIKEHERVILKQILQIL   49
WashU_Scas_Contig718.88   1   ---------------MTTELPEKEGSIIQPSQEVLLNHQCSLVKHYLQSA   35
Symbols






.: . * : .: :: :*: ::*: **



SGD_Scer_SWP82/YFL049W   51   DQDELVQPPLDKFPYKKLELPKYIDELKTRDATNTSYKMIQLDAYGEKKV   100
MIT_Smik_c514_8110   51   GQDELVQAPLDKFPYRKLEVTRYIDDSKTRDVTDTSYKMVQMDAYGEKKT   100
MIT_Spar_c345_7103   51   DQDELVQPPLDKFPYKKLELPVYTDESKTRDATNTSYKMVQMDAYGEKKV   100
MIT_Suva_c781_7206   50   NQDELLQAPLDRFPYRTLELPRYTDQSKTRDATNTSYIMEQRDVYGEKKI   99
WashU_Sbay_Contig629.3   50   NQDELLQAPLDRFPYRTLELPRYTDQSKTRDATNTSYIMEQRDVYGEKKI   99
WashU_Scas_Contig718.88   36   SNNELLQEPVFEPPKTLINLPSYIDKEAP--IQKYDYKMTIKDSHGERKI   83
Symbols






.::**:* *: . * :::. * *. . . .* * * :**:*



SGD_Scer_SWP82/YFL049W   101   GSNGELFGGRHYLFNTFTFTAHMGVLLVLLQDVIKVLYQSNATHDEDEFI   150
MIT_Smik_c514_8110   101   SLKGKLFGGRQFLFNTFMFMAHGDVLLVLLQDVIKVLYQDETMPDENEFI   150
MIT_Spar_c345_7103   101   GLNGELFGGRHYLFNTFTFMAHTDVLLVLLQDVIKVLYQSDTKHDGDEFI   150
MIT_Suva_c781_7206   100   GLNGELFGGRHYLFNMFTFTASGNILLTLLQDVIKVLYQDDLKHDENEFI   149
WashU_Sbay_Contig629.3   100   GLNGELFGGRHYLFNMFTFTASGNILLTLLQDVIKVLYQDDLKHDENEFI   149
WashU_Scas_Contig718.88   84   TDKGNLLGNRSFLFSTFSIPKTGAISFVLLTDLLDCLKFKG---AFDEFL   130
Symbols






:*:*:*.* :**. * : : :.** *::. * . :**:



SGD_Scer_SWP82/YFL049W   151   VQHDQILVMETSEEQTKFLAKN----GVIPEESKGSFKYITARSAFVEFG   196
MIT_Smik_c514_8110   151   GRHDQFLIMETSEEQTIFLVKN----GVLPEGSNGPFRYITARSAFVEFG   196
MIT_Spar_c345_7103   151   DQHDQILIMETSEEQTNFLAKN----GILPEGSNGSFKYVTARSAFVEFG   196
MIT_Suva_c781_7206   150   EQHSQILVKETTEDQTNFLIRH----GILPKGCVGSFKYITAKSAFVEFN   195
WashU_Sbay_Contig629.3   150   EQHSQILVKETTEDQTNFLIRH----GILPKGCVGSFKYITAKSAFVEFN   195
WashU_Scas_Contig718.88   131   RINGNLYPIEADEETTHFLRTNNLISSIADSGNDSNIIYVTARSVFIQFG   180
Symbols






:.:: *: *: * ** : .: . . : *:**:*.*::*.



SGD_Scer_SWP82/YFL049W   197   ASVIAGGQRIVDDYWESLAKKQNLSSHQRVFKLSTNLISKISLLRPSFQN   246
MIT_Smik_c514_8110   197   ASVIVGGQRIVDDYWESLAKKQNFSSHQRVFKLTTKLISKISLLRPSFQN   246
MIT_Spar_c345_7103   197   ATVIAGGQRIVDDYWESLAKKQNLSSHQRVFKLTTGLISKISLLRPSFQN   246
MIT_Suva_c781_7206   196   ASVIVGGQRIVDDYWETLAKKQNLSSHQRVFKLTTKLISKISLLRPSFQN   245
WashU_Sbay_Contig629.3   196   ASVIVGGQRIVDDYWETLAKKQNLSSHQRVFKLTTKLISKISLLRPSFQN   245
WashU_Scas_Contig718.88   181   AAVVASGSRVIDDYWEEIAINQGLTPQHRVFCYSKELLDKIFLINPHLAP   230
Symbols






*:*:..*.*::***** :* :*.::.::*** :. *:.** *:.* :



SGD_Scer_SWP82/YFL049W   247   NRISNANEISANTNNTC-TISTSKFESQYPIVTEQPSAEIREAYIENFAK   295
MIT_Smik_c514_8110   247   NKATNTNHTDTGTG----AISDLKFESPYPIVTEQPSAEIREAYIENFAK   292
MIT_Spar_c345_7103   247   NKITNANEFGTNDSNAC-TISNSKFESPYPIVTEQPSAEVREAYIENFAK   295
MIT_Suva_c781_7206   246   NKMSNVKETGKNADTSAGTISNYKFESPYPIVTEQPSAEVREAYIENFAK   295
WashU_Sbay_Contig629.3   246   NKMSNVKETGKNADTSAGTISNYKFESPYPIVTEQPSAEVREAYIENFAK   295
WashU_Scas_Contig718.88   231   KVITSDKDADNAPLG--------PFEPADLTIMEQFSADIRDDYARQFSQ   272
Symbols






: :. :. . **. : ** **::*: * .:*::



SGD_Scer_SWP82/YFL049W   296   GEHISAIVPGQSISGTLELSAQFRVPRYHSKNSFQQALQMKAMDIPIGRH   345
MIT_Smik_c514_8110   293   GEHISAIVPGQSISGTLELSAQFRVPRYHSKNSFQQALQMKAMDIPIGKH   342
MIT_Spar_c345_7103   296   GEHISAIVPGQSISGTLELSAQFRVPRYHSKNSFQQALQMKAMDIPIGRH   345
MIT_Suva_c781_7206   296   GEHISAIVPGQSISGTLELSAQFRVPRYHSKNSFQQSLQMKAMDIPIGKH   345
WashU_Sbay_Contig629.3   296   GEHISAIVPGQSISGTLELSAQFRVPRYHSKNSFQQSLQMKAMDIPIGKH   345
WashU_Scas_Contig718.88   273   GEHIDIVIPGQCINGSLELNAQFRVPKYHSKNSFLQASQINAMDVAIGEH   322
Symbols






****. ::***.*.*:***.******:******* *: *::***:.**.*



SGD_Scer_SWP82/YFL049W   346   EELLAQYESQAPDGS----ASISLPNHIPSVNPSNKPIKRMLSSILDINV   391
MIT_Smik_c514_8110   343   EELLAQYESQASDGS----SLTSLPNNIPSVNPSNKPIKRMLSSILDINV   388
MIT_Spar_c345_7103   346   EDLLAQYESQALDGS----SLTSLPNNIPSVNPSNKPIKRMLSSILDINV   391
MIT_Suva_c781_7206   346   EELLEQYETQTPDGS----TSTSLPNNIPSVNPSNKPIKRMLSSILDINV   391
WashU_Sbay_Contig629.3   346   EELLEQYETQTPDGS----TSTSLPNNIPSVNPSNKPIKRMLSSILDINV   391
WashU_Scas_Contig718.88   323   HKLYTAITEPDTDVSRSNTASLAEPDTSSSAINLNKPIKRMLSSILDMPS   372
Symbols






..* * * : : *: .*. *************:



SGD_Scer_SWP82/YFL049W   392   SSSKNKKSEENEMIKPMNKGQHKNNTSLNINGWKFESLPLKSAENSGKQQ   441
MIT_Smik_c514_8110   389   TSSKNKKSEENEMIKPMNRGLIKNNTSLNINGWKFESLPLKSAEHSGKKQ   438
MIT_Spar_c345_7103   392   SSSKNKKSEENEMIKPMNKGLLKNNTSLNINGWKFESLPLKSPENSGKQQ   441
MIT_Suva_c781_7206   392   SSSKNKKSEENEMIKPMNKGLLKNNTSLNINGWKFESLPLKSTEHSGNQQ   441
WashU_Sbay_Contig629.3   392   SSSKNKKSEENEMIKPMNKGLLKNNTSLNINGWKFESLPLKSTEHSGNQQ   441
WashU_Scas_Contig718.88   373   TTAKDKKSEEFDKIYSNN-GLHSSHIDLNIDGWKFETLPVKSANN-HSEY   420
Symbols






:::*:***** : * . * * ..: .***:*****:**:**.:: .:



SGD_Scer_SWP82/YFL049W   442   YYRGLPLYEKNTLLERLKQLTPNEIKELEHLHDAVFVNTGLQNVRKVRTK   491
MIT_Smik_c514_8110   439   YYRGLPLYEKNALLGRLKQLTPNEIKELEHLHDAVFVNTGLQNVRKVRTK   488
MIT_Spar_c345_7103   442   YYRGLPLYEKNALLERLKQLTPNEIKELEHLHDAVFVNTGLQNVRKVRTK   491
MIT_Suva_c781_7206   442   YYRGLPLYEKTTLLERLKQLTPNEIKELEHLHDAVFVNTGLQNVRKVRTK   491
WashU_Sbay_Contig629.3   442   YYRGLPLYEKTTLLERLKQLTPNEIKELEHLHDAVFVNTGLQNVRKVRTK   491
WashU_Scas_Contig718.88   421   STRGLPNYEKNILFKRLNLLTPNEIKEVEHMHDAVFLNTGLQNLRKIRSK   470
Symbols






**** ***. *: **: ********:**:*****:******:**:*:*



SGD_Scer_SWP82/YFL049W   492   KWKKYWQYKAGIPIGLKRSQLDEFKNKYLKDVLAQTSVTTNFNEITNTDE   541
MIT_Smik_c514_8110   489   KWKKYWQYKAGIPIGLKRFQLDEFENKYLKDVLAQTSVTTNFNEVTNTDE   538
MIT_Spar_c345_7103   492   KWKKYWQYKAGIPIGLKRSQLDEFKNNYLKDVLAQTSVTTNFNEITNTDE   541
MIT_Suva_c781_7206   492   KWKKYWQYKAGIPIGLKRSQVDEFKDQYLKDVLEQTSVTTTFNEVTNMDE   541
WashU_Sbay_Contig629.3   492   KWKKYWQYKAGIPIGLKRSQVDEFKDQYLKDVLEQTSVTTTFNEVTNMDE   541
WashU_Scas_Contig718.88   471   KWTKYWQYKFGAPIGLQKNQNSAFMNRYLTDILNQSSVLTTYNEETNNDE   520
Symbols






**.****** * ****:: * . * :.**.*:* *:** *.:** ** **



SGD_Scer_SWP82/YFL049W   542   TITTKRVPNPNFLGNCNIKDFKPPYIYSHVNKVPQNVAGDKTAVKLDTEV   591
MIT_Smik_c514_8110   539   TITTKRIPNANFLGNCNIKDFKPPYIYPRLSNLPQNTPGNETTVKPDADV   588
MIT_Spar_c345_7103   542   TITTKRIPNPNFLGNCNIKDFKPPYIYSRSNKAPQTITGNKTAVKPDADV   591
MIT_Suva_c781_7206   542   TITTKRIPNANFLGNCNVKGFKPPYIYPRLNKSPQNIPGNKATAKPEVDV   591
WashU_Sbay_Contig629.3   542   TITTKRIPNANFLGNCNVKGFKPPYIYPRLNKSPQNIPGNKATAKPEVDV   591
WashU_Scas_Contig718.88   521   THITTRTPNPNLLKNGNIRGFKPPYVFRNNER------------------   552
Symbols






* *.* **.*:* * *::.*****:: . ..



SGD_Scer_SWP82/YFL049W   592   KNTNANPVVATDPVAAKPDNLANFSNEVAMNN---   623
MIT_Smik_c514_8110   589   KNKNPNSMMMTDAMTTKQGTFSNLINGVSMDKIGK   623
MIT_Spar_c345_7103   592   KNTNPNPMIATDAAATKPNTFANFNNGITMNN---   623
MIT_Suva_c781_7206   592   SSKN-STSTMMTAMATKPGTFANLNNGIATDR---   622
WashU_Sbay_Contig629.3   592   SSKN-STSTMMTAMATKPGTFANLNNGIATDR---   622
WashU_Scas_Contig718.88   
   -----------------------------------   
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_SWP82/YFL049W:

SGD_Scer_SWP82/YFL049W  Length: 624  Mon Nov  7 15:19:33 2016  Type: P  Check: 672  ..

       1  MLGEDEGNTV LEKGNNPSVK QGEVGAVFIV PKILIREHER VILKQILQIL

      51  DQDELVQPPL DKFPYKKLEL PKYIDELKTR DATNTSYKMI QLDAYGEKKV

     101  GSNGELFGGR HYLFNTFTFT AHMGVLLVLL QDVIKVLYQS NATHDEDEFI

     151  VQHDQILVME TSEEQTKFLA KNGVIPEESK GSFKYITARS AFVEFGASVI

     201  AGGQRIVDDY WESLAKKQNL SSHQRVFKLS TNLISKISLL RPSFQNNRIS

     251  NANEISANTN NTCTISTSKF ESQYPIVTEQ PSAEIREAYI ENFAKGEHIS

     301  AIVPGQSISG TLELSAQFRV PRYHSKNSFQ QALQMKAMDI PIGRHEELLA

     351  QYESQAPDGS ASISLPNHIP SVNPSNKPIK RMLSSILDIN VSSSKNKKSE

     401  ENEMIKPMNK GQHKNNTSLN INGWKFESLP LKSAENSGKQ QYYRGLPLYE

     451  KNTLLERLKQ LTPNEIKELE HLHDAVFVNT GLQNVRKVRT KKWKKYWQYK

     501  AGIPIGLKRS QLDEFKNKYL KDVLAQTSVT TNFNEITNTD ETITTKRVPN

     551  PNFLGNCNIK DFKPPYIYSH VNKVPQNVAG DKTAVKLDTE VKNTNANPVV

     601  ATDPVAAKPD NLANFSNEVA MNN*

Protein Sequence for MIT_Smik_c514_8110:

MIT_Smik_c514_8110  Length: 624  Mon Nov  7 15:19:33 2016  Type: P  Check: 7519  ..

       1  MVYEGDGETT RDERSSSSLK QGDIGVVFIV PKILIREHER VILKQILQIL

      51  GQDELVQAPL DKFPYRKLEV TRYIDDSKTR DVTDTSYKMV QMDAYGEKKT

     101  SLKGKLFGGR QFLFNTFMFM AHGDVLLVLL QDVIKVLYQD ETMPDENEFI

     151  GRHDQFLIME TSEEQTIFLV KNGVLPEGSN GPFRYITARS AFVEFGASVI

     201  VGGQRIVDDY WESLAKKQNF SSHQRVFKLT TKLISKISLL RPSFQNNKAT

     251  NTNHTDTGTG AISDLKFESP YPIVTEQPSA EIREAYIENF AKGEHISAIV

     301  PGQSISGTLE LSAQFRVPRY HSKNSFQQAL QMKAMDIPIG KHEELLAQYE

     351  SQASDGSSLT SLPNNIPSVN PSNKPIKRML SSILDINVTS SKNKKSEENE

     401  MIKPMNRGLI KNNTSLNING WKFESLPLKS AEHSGKKQYY RGLPLYEKNA

     451  LLGRLKQLTP NEIKELEHLH DAVFVNTGLQ NVRKVRTKKW KKYWQYKAGI

     501  PIGLKRFQLD EFENKYLKDV LAQTSVTTNF NEVTNTDETI TTKRIPNANF

     551  LGNCNIKDFK PPYIYPRLSN LPQNTPGNET TVKPDADVKN KNPNSMMMTD

     601  AMTTKQGTFS NLINGVSMDK IGK*

Protein Sequence for MIT_Spar_c345_7103:

MIT_Spar_c345_7103  Length: 624  Mon Nov  7 15:19:33 2016  Type: P  Check: 9136  ..

       1  MLDDNDGETV HEDRNNSSLE QGEIGAVFIV PKILIREHER VILKQILQIL

      51  DQDELVQPPL DKFPYKKLEL PVYTDESKTR DATNTSYKMV QMDAYGEKKV

     101  GLNGELFGGR HYLFNTFTFM AHTDVLLVLL QDVIKVLYQS DTKHDGDEFI

     151  DQHDQILIME TSEEQTNFLA KNGILPEGSN GSFKYVTARS AFVEFGATVI

     201  AGGQRIVDDY WESLAKKQNL SSHQRVFKLT TGLISKISLL RPSFQNNKIT

     251  NANEFGTNDS NACTISNSKF ESPYPIVTEQ PSAEVREAYI ENFAKGEHIS

     301  AIVPGQSISG TLELSAQFRV PRYHSKNSFQ QALQMKAMDI PIGRHEDLLA

     351  QYESQALDGS SLTSLPNNIP SVNPSNKPIK RMLSSILDIN VSSSKNKKSE

     401  ENEMIKPMNK GLLKNNTSLN INGWKFESLP LKSPENSGKQ QYYRGLPLYE

     451  KNALLERLKQ LTPNEIKELE HLHDAVFVNT GLQNVRKVRT KKWKKYWQYK

     501  AGIPIGLKRS QLDEFKNNYL KDVLAQTSVT TNFNEITNTD ETITTKRIPN

     551  PNFLGNCNIK DFKPPYIYSR SNKAPQTITG NKTAVKPDAD VKNTNPNPMI

     601  ATDAAATKPN TFANFNNGIT MNN*

Protein Sequence for MIT_Suva_c781_7206:

MIT_Suva_c781_7206  Length: 623  Mon Nov  7 15:19:33 2016  Type: P  Check: 1648  ..

       1  MLGEEVEKAA NGEEVSSSQR DEIGATFLVP KLLIKEHERV ILKQILQILN

      51  QDELLQAPLD RFPYRTLELP RYTDQSKTRD ATNTSYIMEQ RDVYGEKKIG

     101  LNGELFGGRH YLFNMFTFTA SGNILLTLLQ DVIKVLYQDD LKHDENEFIE

     151  QHSQILVKET TEDQTNFLIR HGILPKGCVG SFKYITAKSA FVEFNASVIV

     201  GGQRIVDDYW ETLAKKQNLS SHQRVFKLTT KLISKISLLR PSFQNNKMSN

     251  VKETGKNADT SAGTISNYKF ESPYPIVTEQ PSAEVREAYI ENFAKGEHIS

     301  AIVPGQSISG TLELSAQFRV PRYHSKNSFQ QSLQMKAMDI PIGKHEELLE

     351  QYETQTPDGS TSTSLPNNIP SVNPSNKPIK RMLSSILDIN VSSSKNKKSE

     401  ENEMIKPMNK GLLKNNTSLN INGWKFESLP LKSTEHSGNQ QYYRGLPLYE

     451  KTTLLERLKQ LTPNEIKELE HLHDAVFVNT GLQNVRKVRT KKWKKYWQYK

     501  AGIPIGLKRS QVDEFKDQYL KDVLEQTSVT TTFNEVTNMD ETITTKRIPN

     551  ANFLGNCNVK GFKPPYIYPR LNKSPQNIPG NKATAKPEVD VSSKNSTSTM

     601  MTAMATKPGT FANLNNGIAT DR*

Protein Sequence for WashU_Sbay_Contig629.3:

WashU_Sbay_Contig629.3  Length: 623  Mon Nov  7 15:19:33 2016  Type: P  Check: 1648  ..

       1  MLGEEVEKAA NGEEVSSSQR DEIGATFLVP KLLIKEHERV ILKQILQILN

      51  QDELLQAPLD RFPYRTLELP RYTDQSKTRD ATNTSYIMEQ RDVYGEKKIG

     101  LNGELFGGRH YLFNMFTFTA SGNILLTLLQ DVIKVLYQDD LKHDENEFIE

     151  QHSQILVKET TEDQTNFLIR HGILPKGCVG SFKYITAKSA FVEFNASVIV

     201  GGQRIVDDYW ETLAKKQNLS SHQRVFKLTT KLISKISLLR PSFQNNKMSN

     251  VKETGKNADT SAGTISNYKF ESPYPIVTEQ PSAEVREAYI ENFAKGEHIS

     301  AIVPGQSISG TLELSAQFRV PRYHSKNSFQ QSLQMKAMDI PIGKHEELLE

     351  QYETQTPDGS TSTSLPNNIP SVNPSNKPIK RMLSSILDIN VSSSKNKKSE

     401  ENEMIKPMNK GLLKNNTSLN INGWKFESLP LKSTEHSGNQ QYYRGLPLYE

     451  KTTLLERLKQ LTPNEIKELE HLHDAVFVNT GLQNVRKVRT KKWKKYWQYK

     501  AGIPIGLKRS QVDEFKDQYL KDVLEQTSVT TTFNEVTNMD ETITTKRIPN

     551  ANFLGNCNVK GFKPPYIYPR LNKSPQNIPG NKATAKPEVD VSSKNSTSTM

     601  MTAMATKPGT FANLNNGIAT DR*

Protein Sequence for WashU_Scas_Contig718.88:

WashU_Scas_Contig718.88  Length: 553  Mon Nov  7 15:19:33 2016  Type: P  Check: 8435  ..

       1  MTTELPEKEG SIIQPSQEVL LNHQCSLVKH YLQSASNNEL LQEPVFEPPK

      51  TLINLPSYID KEAPIQKYDY KMTIKDSHGE RKITDKGNLL GNRSFLFSTF

     101  SIPKTGAISF VLLTDLLDCL KFKGAFDEFL RINGNLYPIE ADEETTHFLR

     151  TNNLISSIAD SGNDSNIIYV TARSVFIQFG AAVVASGSRV IDDYWEEIAI

     201  NQGLTPQHRV FCYSKELLDK IFLINPHLAP KVITSDKDAD NAPLGPFEPA

     251  DLTIMEQFSA DIRDDYARQF SQGEHIDIVI PGQCINGSLE LNAQFRVPKY

     301  HSKNSFLQAS QINAMDVAIG EHHKLYTAIT EPDTDVSRSN TASLAEPDTS

     351  SSAINLNKPI KRMLSSILDM PSTTAKDKKS EEFDKIYSNN GLHSSHIDLN

     401  IDGWKFETLP VKSANNHSEY STRGLPNYEK NILFKRLNLL TPNEIKEVEH

     451  MHDAVFLNTG LQNLRKIRSK KWTKYWQYKF GAPIGLQKNQ NSAFMNRYLT

     501  DILNQSSVLT TYNEETNNDE THITTRTPNP NLLKNGNIRG FKPPYVFRNN

     551  ER*