Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YFL017W-A and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_SMX2/YFL017W-A   1   MVSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINGED   50
MIT_Smik_c515_8225   1   MVSTPELKKYMDKKILLNINGSRKIAGILRGYDIFLNVVLDDAMEINGED   50
MIT_Spar_c344_6974   1   MVSTPELKKYMDKKILLNINGSRKVAGVLRGYDIFLNVVLDDAMEINGED   50
MIT_Suva_c36_7545   1   MVSTPELKKYMDKKIMLNINGSRKIAGILRGYDIFLNIVLDDAMEINGED   50
WashU_Sbay_Contig634.38   1   ---------------MLNINGSRKIAGILRGYDIFLNIVLDDAMEINGED   35
WashU_Scas_Contig707.17   1   ----------MDKKILLQLNGSRKVAGILRGYDIFLNVVVDDAVEVSKD-   39
WashU_Sklu_Contig2294.2   1   ----------MEKKVYLQLNGSRKIVGILRGYDIFLNVVLDDAVEVRKD-   39
WashU_Skud_Contig1575.4   1   ----------MDKKILLNINGSRKIAGVLRGYDIFLNVVLDDAMEINGKD   40
WashU_Smik_Contig2242.1   1   ----------MDKKILLNINGSRKIAGILRGYDIFIIVVIDDAMEINGED   40
Symbols






*::*****:.*:*******: :*:***:*: .



SGD_Scer_SMX2/YFL017W-A   51   PANNHQLGLQTVIRGNSIISLEALDAI-   77
MIT_Smik_c515_8225   51   IANNNPLGLQTVIRGNSIISLEALDTI-   77
MIT_Spar_c344_6974   51   PANNHPLGLQTVIRGNSIISLEALDTI-   77
MIT_Suva_c36_7545   51   PASNLPLGLQTVIRGNSIISLEALDNI-   77
WashU_Sbay_Contig634.38   36   PASNLPLGLQTVIRGNSIISLEALDNI-   62
WashU_Scas_Contig707.17   40   -GSKHQLGMQTVIRGNSIVSLEALDTIS   66
WashU_Sklu_Contig2294.2   40   -GNKTPMGSQTVIRGNSIASLEALEALS   66
WashU_Skud_Contig1575.4   41   PASNHPLGLQTVIRGNSIISLEALDTI-   67
WashU_Smik_Contig2242.1   41   IANNNPLGLQTVIRGNSIISLEAVDAI-   67
Symbols






..: :* ********* ****:: :



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_SMX2/YFL017W-A:

SGD_Scer_SMX2/YFL017W-A  Length: 78  Mon Nov  7 15:18:46 2016  Type: P  Check: 77  ..

       1  MVSTPELKKY MDKKILLNIN GSRKVAGILR GYDIFLNVVL DDAMEINGED

      51  PANNHQLGLQ TVIRGNSIIS LEALDAI*

Protein Sequence for MIT_Smik_c515_8225:

MIT_Smik_c515_8225  Length: 78  Mon Nov  7 15:18:46 2016  Type: P  Check: 30  ..

       1  MVSTPELKKY MDKKILLNIN GSRKIAGILR GYDIFLNVVL DDAMEINGED

      51  IANNNPLGLQ TVIRGNSIIS LEALDTI*

Protein Sequence for MIT_Spar_c344_6974:

MIT_Spar_c344_6974  Length: 78  Mon Nov  7 15:18:46 2016  Type: P  Check: 746  ..

       1  MVSTPELKKY MDKKILLNIN GSRKVAGVLR GYDIFLNVVL DDAMEINGED

      51  PANNHPLGLQ TVIRGNSIIS LEALDTI*

Protein Sequence for MIT_Suva_c36_7545:

MIT_Suva_c36_7545  Length: 78  Mon Nov  7 15:18:46 2016  Type: P  Check: 9950  ..

       1  MVSTPELKKY MDKKIMLNIN GSRKIAGILR GYDIFLNIVL DDAMEINGED

      51  PASNLPLGLQ TVIRGNSIIS LEALDNI*

Protein Sequence for WashU_Sbay_Contig634.38:

WashU_Sbay_Contig634.38  Length: 63  Mon Nov  7 15:18:46 2016  Type: P  Check: 6415  ..

       1  MLNINGSRKI AGILRGYDIF LNIVLDDAME INGEDPASNL PLGLQTVIRG

      51  NSIISLEALD NI*

Protein Sequence for WashU_Scas_Contig707.17:

WashU_Scas_Contig707.17  Length: 67  Mon Nov  7 15:18:46 2016  Type: P  Check: 1555  ..

       1  MDKKILLQLN GSRKVAGILR GYDIFLNVVV DDAVEVSKDG SKHQLGMQTV

      51  IRGNSIVSLE ALDTIS*

Protein Sequence for WashU_Sklu_Contig2294.2:

WashU_Sklu_Contig2294.2  Length: 67  Mon Nov  7 15:18:46 2016  Type: P  Check: 798  ..

       1  MEKKVYLQLN GSRKIVGILR GYDIFLNVVL DDAVEVRKDG NKTPMGSQTV

      51  IRGNSIASLE ALEALS*

Protein Sequence for WashU_Skud_Contig1575.4:

WashU_Skud_Contig1575.4  Length: 68  Mon Nov  7 15:18:46 2016  Type: P  Check: 390  ..

       1  MDKKILLNIN GSRKIAGVLR GYDIFLNVVL DDAMEINGKD PASNHPLGLQ

      51  TVIRGNSIIS LEALDTI*

Protein Sequence for WashU_Smik_Contig2242.1:

WashU_Smik_Contig2242.1  Length: 68  Mon Nov  7 15:18:46 2016  Type: P  Check: 9286  ..

       1  MDKKILLNIN GSRKIAGILR GYDIFIIVVI DDAMEINGED IANNNPLGLQ

      51  TVIRGNSIIS LEAVDAI*