Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YER166W and Homologs


Choose two or more sequences for alignment:
Pick a sequence type:
Best Hits & Orthologs"Other" Hits

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_DNF1/YER166W   1   ---MSGTFHGDGHAPMSPFEDTFQFEDNSSNEDTHIAPTHFDDGATSNKY   47
MIT_Smik_c3_6187   1   ---MSSAFPGEGHTPMSPFEDTFQFEDNSSNEDTHIGPTHIGDNVSSNKY   47
MIT_Spar_c284_6739   1   ---MSGTFHGEGHTPMSPFEDTFQFEDNSSNEDTHIGPTHIGDGTPSYKY   47
WashU_Scas_Contig576.8   1   MSGNTNPFEDNGNNPMSPFDDNFQFEDIDFDAQPNHSSNTTANNTSSSNA   50
Symbols






:..* .:*: *****:*.***** . : :.: ... :...* :



SGD_Scer_DNF1/YER166W   48   SRPQVSFNDETPKNKREDAEEFTFNDDTEYDNHSFQPTPKLNNGSGTFDD   97
MIT_Smik_c3_6187   48   GRPQVNFNDEAPKNKREDAEEFTFNDDTEYDNHSFQQTPKLNNGSGTFDD   97
MIT_Spar_c284_6739   48   SRPQVSFNDAAPKSKREDAEEFTFNDDTEYDNHSFQPTPKLNSGSGTFDD   97
WashU_Scas_Contig576.8   51   YHGDSTHLTSFDDSKEK--ESLSFHEDVDNDIHSFEPTPRIGTSNGAFDD   98
Symbols






: : .. ..*.: *.::*::*.: * ***: **::....*:***



SGD_Scer_DNF1/YER166W   98   VELDNDSGEPHTNYDG------MKRFRMGTKRNKKGNPIMGRSKTLKWAR   141
MIT_Smik_c3_6187   98   VELDNDNGEPHTNYDG------MKRFRMGTKRNKKGNPITGRSKTLKWAR   141
MIT_Spar_c284_6739   98   VELDNDNGEPHTNYDG------MKRFRMGTKRNKKGNPIMGRSKTLKWAK   141
WashU_Scas_Contig576.8   99   ISLENDDHDPSSSHHHSTSENIMKRLRMGTQRNKKGKPTVGRAKTLKWAQ   148
Symbols






:.*:**. :* :.:. ***:****:*****:* **:******:



SGD_Scer_DNF1/YER166W   142   KNIPNPFEDFTKDD---IDPGAINRAQELRTVYYNMPLPKDMIDEEGNPI   188
MIT_Smik_c3_6187   142   KNIPNPFEDFTKDD---IDPGAINRAQELRTVYYNMPLPKNMIDEEGNPI   188
MIT_Spar_c284_6739   142   KNIPNPFEDFTKDD---IDPGAINRAQELRTVYYNMPLPKNMIDEEGNPI   188
WashU_Scas_Contig576.8   149   KTFVNPFEESNNRDDIFDDAGLTNRASELRTVYYNMPLPKEMVDEDGKPI   198
Symbols






*.: ****: .: * *.* ***.*************:*:**:*:**



SGD_Scer_DNF1/YER166W   189   MQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVT   238
MIT_Smik_c3_6187   189   IQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVT   238
MIT_Spar_c284_6739   189   MQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVT   238
WashU_Scas_Contig576.8   199   TDYPRNKIRTTKYSPLNFFPKNIMFQFQNFANVYFLVLIILGAFQIFGVT   248
Symbols






:***********:**.*:****:***:**********************



SGD_Scer_DNF1/YER166W   239   NPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVENENV   288
MIT_Smik_c3_6187   239   NPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVDNENV   288
MIT_Spar_c284_6739   239   NPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVDNENV   288
WashU_Scas_Contig576.8   249   NPGLAAVPLIVIVIITAIKDAIEDSRRTLLDMEVNNTRTHILEGVDNGNV   298
Symbols






****:****:******************:**:*****:*******:* **



SGD_Scer_DNF1/YER166W   289   STDNISLWRRFKKANSRLLFKFIQYCKEHLTEEGKKKRMQRKRHELRVQK   338
MIT_Smik_c3_6187   289   STDNISLWRKFKKANSKLLFKFIQYCKEHLTEEGKMKRMQRKRHELRVQK   338
MIT_Spar_c284_6739   289   STDNISLWRKFKKANSRLLFKFIQYCKEHLTEEGKKRRMQRKRHELRVQK   338
WashU_Scas_Contig576.8   299   SVDNVSLWRRFKKANTRLLMKFIEYCKSHFTEEGRQKRRQHKRHILRSQT   348
Symbols






*.**:****:*****::**:***:***.*:****: :* *:*** ** *.



SGD_Scer_DNF1/YER166W   339   TVG---TSGPRSSLDSIDSYRVSADYGRPSLDYDNLEQGAGEAN---IVD   382
MIT_Smik_c3_6187   339   TVG---TSGPRSSLDSIDSYRASADYGRPSLDYDNLEQGVGEAN---IVD   382
MIT_Spar_c284_6739   339   TVG---TSGPRSSLDSIDSYRISADYGRPSLDYDNLEQAAGEAN---IVD   382
WashU_Scas_Contig576.8   349   AAINGGIDMARNSLDSIGSYRMSGDYGRPSLEYDTVGQSALKTDNANIMD   398
Symbols






:. . .*.*****.*** *.*******:**.: *.. ::: *:*



SGD_Scer_DNF1/YER166W   383   RSLPPRTDCKFAKNYWKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACY   432
MIT_Smik_c3_6187   383   RSLPPRTDCKFAKNYWKSVKVGDIVRIHNNDEIPADIILLSTSDADGACY   432
MIT_Spar_c284_6739   383   RSLPPRIDCKFAKNYWKSVKVGDIVRIHNNDEIPADIILLSTSDTDGACY   432
WashU_Scas_Contig576.8   399   RSLPPRSDCKFSKDYWKNVKVGDIVRIHNNDEIPADIILLSTSDSDGGCY   448
Symbols






****** ****:*:***.**************************:**.**



SGD_Scer_DNF1/YER166W   433   VETKNLDGETNLKVRQSLKCTNTIRTSKDIARTKFWIESEGPHSNLYTYQ   482
MIT_Smik_c3_6187   433   LETKNLDGETNLKVRQSLKCANTIRTSRDIARTKFWIESEGPHSNLYTYQ   482
MIT_Spar_c284_6739   433   VETKNLDGETNLKVRQSLKCTNTIRTSKDIARTKFWIESEGPHSNLYTYQ   482
WashU_Scas_Contig576.8   449   LETKNLDGETNLKVRESLKCSHSIRNSRDIARTKFWVESEGPHANLYSYQ   498
Symbols






:**************:****:::**.*:********:******:***:**



SGD_Scer_DNF1/YER166W   483   GNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMGVVMFTGGDTKIM   532
MIT_Smik_c3_6187   483   GNMKWRSLADGETRNEPITINNVLLRGCTLRNTKWAMGIVMFTGDDTKIM   532
MIT_Spar_c284_6739   483   GNMKWRSLADGEIRNEPITINNVLLRGCTLRNTKWAMGVVMFTGDDTKIM   532
WashU_Scas_Contig576.8   499   GNVKWVDSKDGDLKNEPVTINNLLLRGCTLRNTKWAMGMVVFTGDDTKIM   548
Symbols






**:** . **: :***:****:***************:*:***.*****



SGD_Scer_DNF1/YER166W   533   LNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKKGRSR   582
MIT_Smik_c3_6187   533   LNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKKGRSR   582
MIT_Spar_c284_6739   533   LNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKRGRSR   582
WashU_Scas_Contig576.8   549   LNSGATPTKKSRISRELNLSVSLNFLFLFIICFISAIINGVDYDKHPRSR   598
Symbols






**** *************:** :**::***:**:*.* *** ***: ***



SGD_Scer_DNF1/YER166W   583   FSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFI   632
MIT_Smik_c3_6187   583   FSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFI   632
MIT_Spar_c284_6739   583   FSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFI   632
WashU_Scas_Contig576.8   599   DFFEFGTVAGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFI   648
Symbols






:****:****:*************************************



SGD_Scer_DNF1/YER166W   633   YGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKC   682
MIT_Smik_c3_6187   633   YGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKC   682
MIT_Spar_c284_6739   633   YGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKC   682
WashU_Scas_Contig576.8   649   YGDVLLYNAKLDYPCTPKSWNISDDMGQIEYIFSDKTGTLTQNVMEFKKC   698
Symbols






*************************:**:*********************



SGD_Scer_DNF1/YER166W   683   TINGVSYGRAYTEALAGLRKRQGIDVETEGRREKAEIAKDRDTMIDELRA   732
MIT_Smik_c3_6187   683   TINGVSYGRAYTEALAGLRKRQGIDVETEGRRERAEIAKDRDTMIDELRA   732
MIT_Spar_c284_6739   683   TINGVSYGRAYTEALAGLRKRQGIDVETEGRREKAEITKDRDTMIDELRA   732
WashU_Scas_Contig576.8   699   TINGISYGRAYTEALAGLRKRQGIDVEEEGRREKEEIAKDRDTMINTLRN   748
Symbols






****:********************** *****: **:*******: **



SGD_Scer_DNF1/YER166W   733   LSGNSQFYPEEVTFVSKEFVRDLKGASGEVQQRCCEHFMLALALCHSVLV   782
MIT_Smik_c3_6187   733   LSGNSQFYPEEVTFVSKEFVRDLKGASGEIQQRCCEHFMLALALCHSVLV   782
MIT_Spar_c284_6739   733   LSGNSQFYPEEVTFVSKEFVRDLKGASGEVQRRCCEHFMLALALCHSVLV   782
WashU_Scas_Contig576.8   749   LSHNSQFYPDDITFISKEFVNDLKGASGDMQQKCCEHFMLALALCHSVLV   798
Symbols






** ******:::**:*****.*******::*::*****************



SGD_Scer_DNF1/YER166W   783   EANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGLIIEMQGIQK   832
MIT_Smik_c3_6187   783   EANPDDPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGLIVEMQGIQK   832
MIT_Spar_c284_6739   783   EANPDDPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGVIIEMQGIQK   832
WashU_Scas_Contig576.8   799   EPNKHDSKKLDVKAQSPDEAALVCTARDVGFSFIGKTKTGLIIEVQGVQK   848
Symbols






*.* .:.****:***********.*********:****.*:*:*:**:**



SGD_Scer_DNF1/YER166W   833   EFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLS   882
MIT_Smik_c3_6187   833   EFEILNILEFNSSRKRMSCIVKIPGLNPEDEPKALLICKGADSIIYSRLS   882
MIT_Spar_c284_6739   833   EFEILNILEFNSSRKRMSCIVKIPGLNPGDEPKALLICKGADSIIYSRLS   882
WashU_Scas_Contig576.8   849   EFQILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKGADSIIYSRLG   898
Symbols






**:*** *****:************ ** ***:****************.



SGD_Scer_DNF1/YER166W   883   RQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDI   932
MIT_Smik_c3_6187   883   RQSGNNNETVLEKTALHLEQYATEGLRTLCIAQRELSWSEYKKWNERYDI   932
MIT_Spar_c284_6739   883   RQSGSNSEVVLEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDI   932
WashU_Scas_Contig576.8   899   TKNGANSENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDI   948
Symbols






:.* *.* :****************************.** :**::***



SGD_Scer_DNF1/YER166W   933   AAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAG   982
MIT_Smik_c3_6187   933   AAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAG   982
MIT_Spar_c284_6739   933   AAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAQAG   982
WashU_Scas_Contig576.8   949   AAASVTNREEQLEAVSDEIERELTLLGGTAIEDRLQDGVPESISILAQAG   998
Symbols






****::***::**.*:*.***** ****************:.*.:**:**



SGD_Scer_DNF1/YER166W   983   IKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEI   1032
MIT_Smik_c3_6187   983   IKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKTSGDDVKEFGSEPSEI   1032
MIT_Spar_c284_6739   983   IKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEI   1032
WashU_Scas_Contig576.8   999   IKLWVLTGDKVETAINIGFSCNLLNNDMELLVVKTNGDDVQEFGNDPAEI   1048
Symbols






**************************:*****:**.****:***.:*:**



SGD_Scer_DNF1/YER166W   1033   VDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYAIVIDGDALKLALY   1082
MIT_Smik_c3_6187   1033   VDSLLSKYLKEYFGLHGTEEEIFEAKKDHEFPKGNYAVVIDGDALKLALY   1082
MIT_Spar_c284_6739   1033   VDALLSKYLKQYFGLNGSEEEVFEAKKDHEFPKGNYAVVIDGDALKLALY   1082
WashU_Scas_Contig576.8   1049   AESLITKYLREKFGLTGSEMELADAKKNHDFPRGDFAVVIDGEALKLALN   1098
Symbols






.::*::***:: *.* *:* *: :***:*:**:*::*:****:******



SGD_Scer_DNF1/YER166W   1083   GEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGS   1132
MIT_Smik_c3_6187   1083   GEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGS   1132
MIT_Spar_c284_6739   1083   GEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGS   1132
WashU_Scas_Contig576.8   1099   GESIRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVMTSLDVMTLAIGDGS   1148
Symbols






**.************:*********:********* *************



SGD_Scer_DNF1/YER166W   1133   NDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYK   1182
MIT_Smik_c3_6187   1133   NDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYK   1182
MIT_Spar_c284_6739   1133   NDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYK   1182
WashU_Scas_Contig576.8   1149   NDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYLTRLVLVHGRWSYR   1198
Symbols






************:************************:***********:



SGD_Scer_DNF1/YER166W   1183   RLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSL   1232
MIT_Smik_c3_6187   1183   RLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSL   1232
MIT_Spar_c284_6739   1183   RLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSL   1232
WashU_Scas_Contig576.8   1199   RLAEMIPAFFYKNVIFTLALFWYGIYNNFDGSYLFEYTFLMFYNLAFTSL   1248
Symbols






******* *****:**:**********:******:***::**********



SGD_Scer_DNF1/YER166W   1233   PVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSI   1282
MIT_Smik_c3_6187   1233   PVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSI   1282
MIT_Spar_c284_6739   1233   PVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSI   1282
WashU_Scas_Contig576.8   1249   PVIFMGIMDQDVSDTVSLVMPQLYRSGILRLDWNQTKFLWYMLDGLYQSC   1298
Symbols






****:**:****.**:***:***** **** :*** *************



SGD_Scer_DNF1/YER166W   1283   ICFFFPYLVYHKNMIVTSNGLGLDHRYFVGVYVTTIAVISCNTYVLLHQY   1332
MIT_Smik_c3_6187   1283   ICFFFPYLVYRKNMVVTSNGLGLDHRYFVGVYVTTIAVISCNTYVLLHQY   1332
MIT_Spar_c284_6739   1283   ICFFFPYLVYHKNMIVTSNGLGLDHRYFVGVYVTTIAVISCNTYVLLHQY   1332
WashU_Scas_Contig576.8   1299   ICFFFPYCLYHKNQIVSNNGLGLDHRFYVGVMVTSLAVVSCNIYMLLHQY   1348
Symbols






******* :*:** :*:.********::*** **::**:*** *:*****



SGD_Scer_DNF1/YER166W   1333   RWDWFSGLFIALSCLVVFAWTGIWSSAIASREFFKAAARIYGAPSFWAVF   1382
MIT_Smik_c3_6187   1333   RWDWFSGLFIALSCLVVFAWTGIWSSAIGSREFFKAAARIYGAPSFWAVF   1382
MIT_Spar_c284_6739   1333   RWDWFSGLFIALSCLVVFAWTGIWSSAIASREFFKAAARIYGAPSFWAVF   1382
WashU_Scas_Contig576.8   1349   RWDWFSCLFIGLSCIILFFWTGVWSSSLTSKEFFKAASRIYGAPSFWGVF   1398
Symbols






****** ***.***:::* ***:***:: *:******:*********.**



SGD_Scer_DNF1/YER166W   1383   FVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQHGHFDHYPPGYDPTDP   1432
MIT_Smik_c3_6187   1383   FVAVLFCLLPRFTYDSFQKFFYPTDVEIIREMWQHGHFDHYPAGYDPTDP   1432
MIT_Spar_c284_6739   1383   FVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQHGHFDHYPAGYDPTDP   1432
WashU_Scas_Contig576.8   1399   FVGIVYCLLPRFTLDCFRKFFYPTDVEIVREMWQRGDFSHYPPGYDPTDP   1448
Symbols






**.:::******* *.*:**********:*****:*.*.***.*******



SGD_Scer_DNF1/YER166W   1433   NRPKVTKAGQHGEKIIEGIALSDNLGGSNYSRDSVVTEEIPMTFMHGEDG   1482
MIT_Smik_c3_6187   1433   NRPKVTKAGQHGEKIIEGITLSDNLGASNYSRDSVVTEEIPMSFIRAENG   1482
MIT_Spar_c284_6739   1433   NRPKVTKAGQHGEKIIEGIALSDNLGGSNYSRDSVVTEEIPMTFMHGEDG   1482
WashU_Scas_Contig576.8   1449   NRPKVAKSGKFGERIVEGIHLSQSFGENNFSHESVATEEIPMNILHTDAG   1498
Symbols






*****:*:*:.**:*:*** **:.:* .*:*::**.******.::: : *



SGD_Scer_DNF1/YER166W   1483   SPSGYQKQETWMTSPKETQDLLQSPQFQQAQTFGRGPSTNVRSSLDRTRE   1532
MIT_Smik_c3_6187   1483   SPSRYQKPESWMTSPKETQDLLQSPQFQQTQAFETVPATNLRSSLDRTRE   1532
MIT_Spar_c284_6739   1483   SPSGYQKQEAWMTSPKETQDLLQSPQFQQTQKFGAGPSTNVRSSLDRTRE   1532
WashU_Scas_Contig576.8   1499   QTIRRDTQDQWASSPKETQDLLFSPRLNQEQEQ-RQKSNLGRSSLERTRE   1547
Symbols






.. :. : * :********* **:::* * :. ****:****



SGD_Scer_DNF1/YER166W   1533   QMIATNQLDNRYSVERARTSLDLPGVTNAASLIGTQQNN-----   1571
MIT_Smik_c3_6187   1533   QMMATHQLDHRYSVERARTSLDLPGITNAASLIGTQQNS-----   1571
MIT_Spar_c284_6739   1533   QMMATHQLDNRYSIERARTSLDLPGVTNAASLIETQRNN-----   1571
WashU_Scas_Contig576.8   1548   DMLATNQLDNRYSVEKARTSLDLPGVTHAASLVGKRKSTTREIL   1591
Symbols






:*:**:***:***:*:*********:*:****: .::..



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_DNF1/YER166W:

SGD_Scer_DNF1/YER166W  Length: 1572  Mon Nov  7 15:17:39 2016  Type: P  Check: 3701  ..

       1  MSGTFHGDGH APMSPFEDTF QFEDNSSNED THIAPTHFDD GATSNKYSRP

      51  QVSFNDETPK NKREDAEEFT FNDDTEYDNH SFQPTPKLNN GSGTFDDVEL

     101  DNDSGEPHTN YDGMKRFRMG TKRNKKGNPI MGRSKTLKWA RKNIPNPFED

     151  FTKDDIDPGA INRAQELRTV YYNMPLPKDM IDEEGNPIMQ YPRNKIRTTK

     201  YTPLTFLPKN ILFQFHNFAN VYFLVLIILG AFQIFGVTNP GLSAVPLVVI

     251  VIITAIKDAI EDSRRTVLDL EVNNTKTHIL EGVENENVST DNISLWRRFK

     301  KANSRLLFKF IQYCKEHLTE EGKKKRMQRK RHELRVQKTV GTSGPRSSLD

     351  SIDSYRVSAD YGRPSLDYDN LEQGAGEANI VDRSLPPRTD CKFAKNYWKG

     401  VKVGDIVRIH NNDEIPADII LLSTSDTDGA CYVETKNLDG ETNLKVRQSL

     451  KCTNTIRTSK DIARTKFWIE SEGPHSNLYT YQGNMKWRNL ADGEIRNEPI

     501  TINNVLLRGC TLRNTKWAMG VVMFTGGDTK IMLNSGITPT KKSRISRELN

     551  FSVVINFVLL FILCFVSGIA NGVYYDKKGR SRFSYEFGTI AGSAATNGFV

     601  SFWVAVILYQ SLVPISLYIS VEIIKTAQAA FIYGDVLLYN AKLDYPCTPK

     651  SWNISDDLGQ VEYIFSDKTG TLTQNVMEFK KCTINGVSYG RAYTEALAGL

     701  RKRQGIDVET EGRREKAEIA KDRDTMIDEL RALSGNSQFY PEEVTFVSKE

     751  FVRDLKGASG EVQQRCCEHF MLALALCHSV LVEANPDNPK KLDLKAQSPD

     801  EAALVATARD VGFSFVGKTK KGLIIEMQGI QKEFEILNIL EFNSSRKRMS

     851  CIVKIPGLNP GDEPRALLIC KGADSIIYSR LSRQSGSNSE AILEKTALHL

     901  EQYATEGLRT LCIAQRELSW SEYEKWNEKY DIAAASLANR EDELEVVADS

     951  IERELILLGG TAIEDRLQDG VPDCIELLAE AGIKLWVLTG DKVETAINIG

    1001  FSCNLLNNEM ELLVIKTTGD DVKEFGSEPS EIVDALLSKY LKEYFNLTGS

    1051  EEEIFEAKKD HEFPKGNYAI VIDGDALKLA LYGEDIRRKF LLLCKNCRAV

    1101  LCCRVSPSQK AAVVKLVKDS LDVMTLAIGD GSNDVAMIQS ADVGIGIAGE

    1151  EGRQAVMCSD YAIGQFRYLA RLVLVHGRWS YKRLAEMIPE FFYKNMIFAL

    1201  ALFWYGIYND FDGSYLYEYT YMMFYNLAFT SLPVIFLGIL DQDVNDTISL

    1251  VVPQLYRVGI LRKEWNQRKF LWYMLDGLYQ SIICFFFPYL VYHKNMIVTS

    1301  NGLGLDHRYF VGVYVTTIAV ISCNTYVLLH QYRWDWFSGL FIALSCLVVF

    1351  AWTGIWSSAI ASREFFKAAA RIYGAPSFWA VFFVAVLFCL LPRFTYDSFQ

    1401  KFFYPTDVEI VREMWQHGHF DHYPPGYDPT DPNRPKVTKA GQHGEKIIEG

    1451  IALSDNLGGS NYSRDSVVTE EIPMTFMHGE DGSPSGYQKQ ETWMTSPKET

    1501  QDLLQSPQFQ QAQTFGRGPS TNVRSSLDRT REQMIATNQL DNRYSVERAR

    1551  TSLDLPGVTN AASLIGTQQN N*

Protein Sequence for MIT_Smik_c3_6187:

MIT_Smik_c3_6187  Length: 1572  Mon Nov  7 15:17:39 2016  Type: P  Check: 4245  ..

       1  MSSAFPGEGH TPMSPFEDTF QFEDNSSNED THIGPTHIGD NVSSNKYGRP

      51  QVNFNDEAPK NKREDAEEFT FNDDTEYDNH SFQQTPKLNN GSGTFDDVEL

     101  DNDNGEPHTN YDGMKRFRMG TKRNKKGNPI TGRSKTLKWA RKNIPNPFED

     151  FTKDDIDPGA INRAQELRTV YYNMPLPKNM IDEEGNPIIQ YPRNKIRTTK

     201  YTPLTFLPKN ILFQFHNFAN VYFLVLIILG AFQIFGVTNP GLSAVPLVVI

     251  VIITAIKDAI EDSRRTVLDL EVNNTKTHIL EGVDNENVST DNISLWRKFK

     301  KANSKLLFKF IQYCKEHLTE EGKMKRMQRK RHELRVQKTV GTSGPRSSLD

     351  SIDSYRASAD YGRPSLDYDN LEQGVGEANI VDRSLPPRTD CKFAKNYWKS

     401  VKVGDIVRIH NNDEIPADII LLSTSDADGA CYLETKNLDG ETNLKVRQSL

     451  KCANTIRTSR DIARTKFWIE SEGPHSNLYT YQGNMKWRSL ADGETRNEPI

     501  TINNVLLRGC TLRNTKWAMG IVMFTGDDTK IMLNSGITPT KKSRISRELN

     551  FSVVINFVLL FILCFVSGIA NGVYYDKKGR SRFSYEFGTI AGSAATNGFV

     601  SFWVAVILYQ SLVPISLYIS VEIIKTAQAA FIYGDVLLYN AKLDYPCTPK

     651  SWNISDDLGQ VEYIFSDKTG TLTQNVMEFK KCTINGVSYG RAYTEALAGL

     701  RKRQGIDVET EGRRERAEIA KDRDTMIDEL RALSGNSQFY PEEVTFVSKE

     751  FVRDLKGASG EIQQRCCEHF MLALALCHSV LVEANPDDPK KLDLKAQSPD

     801  EAALVATARD VGFSFVGKTK KGLIVEMQGI QKEFEILNIL EFNSSRKRMS

     851  CIVKIPGLNP EDEPKALLIC KGADSIIYSR LSRQSGNNNE TVLEKTALHL

     901  EQYATEGLRT LCIAQRELSW SEYKKWNERY DIAAASLANR EDELEVVADS

     951  IERELILLGG TAIEDRLQDG VPDCIELLAE AGIKLWVLTG DKVETAINIG

    1001  FSCNLLNNEM ELLVIKTSGD DVKEFGSEPS EIVDSLLSKY LKEYFGLHGT

    1051  EEEIFEAKKD HEFPKGNYAV VIDGDALKLA LYGEDIRRKF LLLCKNCRAV

    1101  LCCRVSPSQK AAVVKLVKDS LDVMTLAIGD GSNDVAMIQS ADVGIGIAGE

    1151  EGRQAVMCSD YAIGQFRYLA RLVLVHGRWS YKRLAEMIPE FFYKNMIFAL

    1201  ALFWYGIYND FDGSYLYEYT YMMFYNLAFT SLPVIFLGIL DQDVNDTISL

    1251  VVPQLYRVGI LRKEWNQRKF LWYMLDGLYQ SIICFFFPYL VYRKNMVVTS

    1301  NGLGLDHRYF VGVYVTTIAV ISCNTYVLLH QYRWDWFSGL FIALSCLVVF

    1351  AWTGIWSSAI GSREFFKAAA RIYGAPSFWA VFFVAVLFCL LPRFTYDSFQ

    1401  KFFYPTDVEI IREMWQHGHF DHYPAGYDPT DPNRPKVTKA GQHGEKIIEG

    1451  ITLSDNLGAS NYSRDSVVTE EIPMSFIRAE NGSPSRYQKP ESWMTSPKET

    1501  QDLLQSPQFQ QTQAFETVPA TNLRSSLDRT REQMMATHQL DHRYSVERAR

    1551  TSLDLPGITN AASLIGTQQN S*

Protein Sequence for MIT_Spar_c284_6739:

MIT_Spar_c284_6739  Length: 1572  Mon Nov  7 15:17:39 2016  Type: P  Check: 5545  ..

       1  MSGTFHGEGH TPMSPFEDTF QFEDNSSNED THIGPTHIGD GTPSYKYSRP

      51  QVSFNDAAPK SKREDAEEFT FNDDTEYDNH SFQPTPKLNS GSGTFDDVEL

     101  DNDNGEPHTN YDGMKRFRMG TKRNKKGNPI MGRSKTLKWA KKNIPNPFED

     151  FTKDDIDPGA INRAQELRTV YYNMPLPKNM IDEEGNPIMQ YPRNKIRTTK

     201  YTPLTFLPKN ILFQFHNFAN VYFLVLIILG AFQIFGVTNP GLSAVPLVVI

     251  VIITAIKDAI EDSRRTVLDL EVNNTKTHIL EGVDNENVST DNISLWRKFK

     301  KANSRLLFKF IQYCKEHLTE EGKKRRMQRK RHELRVQKTV GTSGPRSSLD

     351  SIDSYRISAD YGRPSLDYDN LEQAAGEANI VDRSLPPRID CKFAKNYWKS

     401  VKVGDIVRIH NNDEIPADII LLSTSDTDGA CYVETKNLDG ETNLKVRQSL

     451  KCTNTIRTSK DIARTKFWIE SEGPHSNLYT YQGNMKWRSL ADGEIRNEPI

     501  TINNVLLRGC TLRNTKWAMG VVMFTGDDTK IMLNSGITPT KKSRISRELN

     551  FSVVINFVLL FILCFVSGIA NGVYYDKRGR SRFSYEFGTI AGSAATNGFV

     601  SFWVAVILYQ SLVPISLYIS VEIIKTAQAA FIYGDVLLYN AKLDYPCTPK

     651  SWNISDDLGQ VEYIFSDKTG TLTQNVMEFK KCTINGVSYG RAYTEALAGL

     701  RKRQGIDVET EGRREKAEIT KDRDTMIDEL RALSGNSQFY PEEVTFVSKE

     751  FVRDLKGASG EVQRRCCEHF MLALALCHSV LVEANPDDPK KLDLKAQSPD

     801  EAALVATARD VGFSFVGKTK KGVIIEMQGI QKEFEILNIL EFNSSRKRMS

     851  CIVKIPGLNP GDEPKALLIC KGADSIIYSR LSRQSGSNSE VVLEKTALHL

     901  EQYATEGLRT LCIAQRELSW SEYEKWNEKY DIAAASLANR EDELEVVADS

     951  IERELILLGG TAIEDRLQDG VPDCIELLAQ AGIKLWVLTG DKVETAINIG

    1001  FSCNLLNNEM ELLVIKTTGD DVKEFGSEPS EIVDALLSKY LKQYFGLNGS

    1051  EEEVFEAKKD HEFPKGNYAV VIDGDALKLA LYGEDIRRKF LLLCKNCRAV

    1101  LCCRVSPSQK AAVVKLVKDS LDVMTLAIGD GSNDVAMIQS ADVGIGIAGE

    1151  EGRQAVMCSD YAIGQFRYLA RLVLVHGRWS YKRLAEMIPE FFYKNMIFAL

    1201  ALFWYGIYND FDGSYLYEYT YMMFYNLAFT SLPVIFLGIL DQDVNDTISL

    1251  VVPQLYRVGI LRKEWNQRKF LWYMLDGLYQ SIICFFFPYL VYHKNMIVTS

    1301  NGLGLDHRYF VGVYVTTIAV ISCNTYVLLH QYRWDWFSGL FIALSCLVVF

    1351  AWTGIWSSAI ASREFFKAAA RIYGAPSFWA VFFVAVLFCL LPRFTYDSFQ

    1401  KFFYPTDVEI VREMWQHGHF DHYPAGYDPT DPNRPKVTKA GQHGEKIIEG

    1451  IALSDNLGGS NYSRDSVVTE EIPMTFMHGE DGSPSGYQKQ EAWMTSPKET

    1501  QDLLQSPQFQ QTQKFGAGPS TNVRSSLDRT REQMMATHQL DNRYSIERAR

    1551  TSLDLPGVTN AASLIETQRN N*

Protein Sequence for WashU_Scas_Contig576.8:

WashU_Scas_Contig576.8  Length: 1592  Mon Nov  7 15:17:39 2016  Type: P  Check: 6102  ..

       1  MSGNTNPFED NGNNPMSPFD DNFQFEDIDF DAQPNHSSNT TANNTSSSNA

      51  YHGDSTHLTS FDDSKEKESL SFHEDVDNDI HSFEPTPRIG TSNGAFDDIS

     101  LENDDHDPSS SHHHSTSENI MKRLRMGTQR NKKGKPTVGR AKTLKWAQKT

     151  FVNPFEESNN RDDIFDDAGL TNRASELRTV YYNMPLPKEM VDEDGKPITD

     201  YPRNKIRTTK YSPLNFFPKN IMFQFQNFAN VYFLVLIILG AFQIFGVTNP

     251  GLAAVPLIVI VIITAIKDAI EDSRRTLLDM EVNNTRTHIL EGVDNGNVSV

     301  DNVSLWRRFK KANTRLLMKF IEYCKSHFTE EGRQKRRQHK RHILRSQTAA

     351  INGGIDMARN SLDSIGSYRM SGDYGRPSLE YDTVGQSALK TDNANIMDRS

     401  LPPRSDCKFS KDYWKNVKVG DIVRIHNNDE IPADIILLST SDSDGGCYLE

     451  TKNLDGETNL KVRESLKCSH SIRNSRDIAR TKFWVESEGP HANLYSYQGN

     501  VKWVDSKDGD LKNEPVTINN LLLRGCTLRN TKWAMGMVVF TGDDTKIMLN

     551  SGATPTKKSR ISRELNLSVS LNFLFLFIIC FISAIINGVD YDKHPRSRDF

     601  FEFGTVAGSA STNGFVSFWV AVILYQSLVP ISLYISVEII KTAQAAFIYG

     651  DVLLYNAKLD YPCTPKSWNI SDDMGQIEYI FSDKTGTLTQ NVMEFKKCTI

     701  NGISYGRAYT EALAGLRKRQ GIDVEEEGRR EKEEIAKDRD TMINTLRNLS

     751  HNSQFYPDDI TFISKEFVND LKGASGDMQQ KCCEHFMLAL ALCHSVLVEP

     801  NKHDSKKLDV KAQSPDEAAL VCTARDVGFS FIGKTKTGLI IEVQGVQKEF

     851  QILNTLEFNS TRKRMSCIVK IPGANPDDEP RALLICKGAD SIIYSRLGTK

     901  NGANSENLLE KTALHLEQYA TEGLRTLCIA QRELSWPEYL EWNKRYDIAA

     951  ASVTNREEQL EAVSDEIERE LTLLGGTAIE DRLQDGVPES ISILAQAGIK

    1001  LWVLTGDKVE TAINIGFSCN LLNNDMELLV VKTNGDDVQE FGNDPAEIAE

    1051  SLITKYLREK FGLTGSEMEL ADAKKNHDFP RGDFAVVIDG EALKLALNGE

    1101  SIRRKFLLLC KNCKAVLCCR VSPAQKAAVV KLVMTSLDVM TLAIGDGSND

    1151  VAMIQSADVG VGIAGEEGRQ AVMCSDYAIG QFRYLTRLVL VHGRWSYRRL

    1201  AEMIPAFFYK NVIFTLALFW YGIYNNFDGS YLFEYTFLMF YNLAFTSLPV

    1251  IFMGIMDQDV SDTVSLVMPQ LYRSGILRLD WNQTKFLWYM LDGLYQSCIC

    1301  FFFPYCLYHK NQIVSNNGLG LDHRFYVGVM VTSLAVVSCN IYMLLHQYRW

    1351  DWFSCLFIGL SCIILFFWTG VWSSSLTSKE FFKAASRIYG APSFWGVFFV

    1401  GIVYCLLPRF TLDCFRKFFY PTDVEIVREM WQRGDFSHYP PGYDPTDPNR

    1451  PKVAKSGKFG ERIVEGIHLS QSFGENNFSH ESVATEEIPM NILHTDAGQT

    1501  IRRDTQDQWA SSPKETQDLL FSPRLNQEQE QRQKSNLGRS SLERTREDML

    1551  ATNQLDNRYS VEKARTSLDL PGVTHAASLV GKRKSTTREI L*