Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YER151C and Homologs


Choose two or more sequences for alignment:
Pick a sequence type:
Best Hits & Orthologs"Other" Hits

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_UBP3/YER151C   1   ----MNMQDANKEESYSMYPKTSSPPPPTPTNMQIPIYQAPLQMYGYTQA   46
MIT_Smik_c843_6269   1   ----MNMQDANKEESYSMYPKTSSPPPPTPTNMQIPIYQAPLQMYGYTQA   46
MIT_Suva_c368_6608   1   ----MNMQDTNKEESYSMYPKTSSPPPPTPTNMQIPIYQAPMQMYGYTQA   46
WashU_Sbay_Contig677.12   1   ----MNMQDTNKEESYSMYPKTSSPPPPTPTNMQIPIYQAPMQMYGYTQA   46
WashU_Scas_Contig555.6   1   -------MSETKEESTSMYPPTNSPPQPQANMHFPVHYQATAPMQMYPFQ   43
WashU_Sklu_Contig1620.2   1   MTDSNPKDNKQDQSSYSMYPPTSPVAPPANMQYNINMYGNPAAAAAFAQY   50
Symbols






. .:.* **** *.. . * * . :.



SGD_Scer_UBP3/YER151C   47   PYLYPTQIPAYSFNMVNQNQPIYHQSGSPHHLPPQNNINGGSTTNNNNIN   96
MIT_Smik_c843_6269   47   PYLYPTQMPAYSFNMVNQNQPMYHQGNSPHHMPPQNSINGGNTTNSSNIG   96
MIT_Suva_c368_6608   47   PYLYPTQMPAYSLNMVTQNQAMYHQNTSPHYLPPQNNINTGSTNGSNSIN   96
WashU_Sbay_Contig677.12   47   PYLYPTQMPAYSLNMVTQNQAMYHQNTSPHYLPPQNNINTGSTNGSNSIN   96
WashU_Scas_Contig555.6   44   SPYMYGQQPAYAFNMVNQNQMMYQNNAGGMPTQGGGNGFNGSKKKYGNNS   93
WashU_Sklu_Contig1620.2   51   GYGYPMPMDVYAG----QGAPFMGYGMNPNMMYYGNGNGNVPQQNPKKKY   96
Symbols






.*: *. : . . .. .



SGD_Scer_UBP3/YER151C   97   KKKWHSNGITNNNGSSGNQGANSSGSGMSYNKSHTYHHNYSNNHIPMMAS   146
MIT_Smik_c843_6269   97   KKKWHSSSVANSSSNNGGSQGANS-NGINYNKSHAYHHSYSNNHIPMMNS   145
MIT_Suva_c368_6608   97   KKKWHSNGPANNSN---GQSANSNGSGVNYNKSHNYHHNYSNSHIPMMNT   143
WashU_Sbay_Contig677.12   97   KKKWHSNGPANNSN---GQSANSNGSGVNYNKSHNYHHNYSNSHIPMMNT   143
WashU_Scas_Contig555.6   94   NMGSKTHNYHQNANSPSYTPTYHSTSNNNLNTHSKRSHSNYNNSTDSTGT   143
WashU_Sklu_Contig1620.2   97   YNNNSNNINNNNNTNSIGSNTSNNISSISTPLNNSKTATSSVTSTGTSTP   146
Symbols






. :. . .. . . . .



SGD_Scer_UBP3/YER151C   147   PNSGSNAGMKKQTNSSNGNGSSATSPSYSSYNSSSQYDLYKFDVTKLKNL   196
MIT_Smik_c843_6269   146   ANNSNNVSMKKQANPSNGNGPSATSPSFSSYNSSSQYDLYKFDVTKLKNF   195
MIT_Suva_c368_6608   144   ANNGNNMPVKKQANSSVANG----STPSPSYNSSSQYDLFKFDVTKLKNF   189
WashU_Sbay_Contig677.12   144   ANNGNNMPVKKQANSSVANG----STPSPSYNSSSQYDLFKFDVTKLKNF   189
WashU_Scas_Contig555.6   144   TTPSYDPFRFDVS-------------------------------------   156
WashU_Sklu_Contig1620.2   147   VSKPVSIVIKNQYKFELGNS----------------------------NS   168
Symbols






. . .



SGD_Scer_UBP3/YER151C   197   KENSSNLIQLPLFINTTEAEFAAASVQRYELNMKALNLNSESLENSSVEK   246
MIT_Smik_c843_6269   196   KENSSSSVQLPLFINTTEAEFATASAQRYELNLKALRLDPESLSEQPVAQ   245
MIT_Suva_c368_6608   190   KENSSNSIQLPLFINTTESEFAAASAQRYDLNLKSLNLESKSAEDQAN--   237
WashU_Sbay_Contig677.12   190   KENSSNSIQLPLFINTTESEFAAASAQRYDLNLKSLNLESKSAEDQAN--   237
WashU_Scas_Contig555.6   157   KLTVTKTLEFPLFVNANQKDYIRARSKRREVRLKTINSVKEINLDINEEE   206
WashU_Sklu_Contig1620.2   169   FSTKNLKLEYPFYVNTDEAEFEQARSKRHFLRLQALNDEISTP-------   211
Symbols






. . :: *:::*: : :: * :* :.::::. .



SGD_Scer_UBP3/YER151C   247   SSAHHHTKSHSIPKHNEEVKTETHGEEED-----AHDKKPHASKDAHELK   291
MIT_Smik_c843_6269   246   SSVHHHAKIHDIPKHNEETKTETHGEEED-----THDKKSNASKDTHEHK   290
MIT_Suva_c368_6608   238   TTTHHHRESHTLPKDGEKLEAEVEAEEVDKEGKDVDDKKPSASKDNREHK   287
WashU_Sbay_Contig677.12   238   TTTHHHRESHTLPKDGEKLEAEVEAEEVDKEGKDVDDKKPSASKDNREHK   287
WashU_Scas_Contig555.6   207   KITEPPKEAEKKVEQKLEPQVEIVSKKDKADEVPKPEKETETKKSSTVTI   256
WashU_Sklu_Contig1620.2   
   --------------------------------------------------   
Symbols










SGD_Scer_UBP3/YER151C   292   KKTEVKKEDAKQDRNE-KVIQEPQATVLPVVDKKEPEESVEENTSKTSSP   340
MIT_Smik_c843_6269   291   RKIEQKEDESTLENSE-QINQEPRSTVAPIAVNKMEAEESIEESTLNTS-   338
MIT_Suva_c368_6608   288   RKIEPKKDDTEKEQGEGAISETYPASEGLPVVGNEELEETADEDTTKASS   337
WashU_Sbay_Contig677.12   288   RKIEPKKDDTEKEQGEGAISETYPASEGLPVVGNEELEETADEDTTKASS   337
WashU_Scas_Contig555.6   257   EKDKAKRSSTPATPKPVLEVVPTESKKKEKENRTKKEESEVALNLPSPEE   306
WashU_Sklu_Contig1620.2   212   ----------TADAEAEIDEATVPLDEGIVEDGPKKEKPSKESPKEDLNE   251
Symbols






: .



SGD_Scer_UBP3/YER151C   341   SPSPPAAKSWSAIASDAIKSRQASNKTVSGSMVTKTPISGTTAGVSSTNM   390
MIT_Smik_c843_6269   339   SPTPPTAKSWSAIASDAIKSRQASNKPVSGSIMTKTSTSGTATSASPTST   388
MIT_Suva_c368_6608   338   SPTLPTAKSWSAIASDAIKSRQASNKSASGSTISQTSASTTATSAPLS--   385
WashU_Sbay_Contig677.12   338   SPTLPTAKSWSAIASDAIKSRQASNKSASGSTISQTSASTTATSAPLS--   385
WashU_Scas_Contig555.6   307   KSSADVVVPTTPAATKAPTPMLWAAVASGGISKVKQASSSSKNLTSTKGA   356
WashU_Sklu_Contig1620.2   252   APSPKSVKSWSAIASSAVS-------------------------------   270
Symbols






.: . . :. *:.* .



SGD_Scer_UBP3/YER151C   391   AAATIGKSSSP-LLSKQPQKKDKKYVPPSTKGIEPLGSIALRMCFDPDFI   439
MIT_Smik_c843_6269   389   VTAAIGKSSSP-LSSKQPQRKDKKYVPPSTKGIEPLGSIALRMCFDPDFI   437
MIT_Suva_c368_6608   386   -TAATAKSNSP-LSSKQPQRKDKKYVPPSTKGIEPLGSIALRMCFDPDFI   433
WashU_Sbay_Contig677.12   386   -TAATAKSNSP-LSSKQPQRKDKKYVPPSTKGIEPLGSIALRMCFDPDFI   433
WashU_Scas_Contig555.6   357   PASVSKSSRSPNALAQAPQKKDSKYVPPSTKGAESLGSIALRMCFDPDFI   406
WashU_Sklu_Contig1620.2   271   ------KPKVS-LSPTPQLKKDKKYVPSTIKSLEPLGVVALRMCLDQDYI   313
Symbols






.. . . :**.****.: *. *.** :*****:* *:*



SGD_Scer_UBP3/YER151C   440   SYVLRNK---DVENKIPVHSIIPRGIINRANICFMSSVLQVLLYCKPFID   486
MIT_Smik_c843_6269   438   SYVLRNK---DIENKIPLHSIIPRGIVNRANICFMSSVLQVLLYCQPFVD   484
MIT_Suva_c368_6608   434   SYVLQNK---DTENKIPLHSIIPRGIINRANICFMSSVLQVLLYCQPFID   480
WashU_Sbay_Contig677.12   434   SYVLQNK---DTENKIPLHSIIPRGIINRANICFMSSVLQVLLYCQPFID   480
WashU_Scas_Contig555.6   407   NYTLKTKQNSNVDRTIPIKSIIPRGIVNMANICFMSSVLQVLLYCKPFID   456
WashU_Sklu_Contig1620.2   314   KYTIEN----VPNAGNAIDSIVPRGIVNTGNICFMSSVLQVLLYCKPFIS   359
Symbols






.*.:.. : .:.**:****:* .***************:**:.



SGD_Scer_UBP3/YER151C   487   VINVLSTRNTNSRVGTSSCKLLDACLTMYKQFDKETYEK----KFLEN--   530
MIT_Smik_c843_6269   485   VLNVLSTRNTNSRIGTSSCKLLDACLTMYKQFDKENYEK----TMEN---   527
MIT_Suva_c368_6608   481   VLNVLSTRNTNSRIGTSSCRLLDACLTMYKQFDVETYEK----SLES---   523
WashU_Sbay_Contig677.12   481   VLNVLSTRNTNSRIGTSSCRLLDACLTMYKQFDVETYEK----SLES---   523
WashU_Scas_Contig555.6   457   ILNVISTRNMYSRVGVSSSRLLDACVNLYKQFDKETVEAQQKEMEESKSL   506
WashU_Sklu_Contig1620.2   360   ILNVISYR-TVAKIGSSVSPSLDACLELYRRFDKQTCENEKKP-------   401
Symbols






::**:* * :::* * . ****: :*::** :. *



SGD_Scer_UBP3/YER151C   531   ---------------------------------ADDAEKTTESDAKKSSK   547
MIT_Smik_c843_6269   528   ---------------------------------AEDTEKSSENDAKKPSK   544
MIT_Suva_c368_6608   524   ---------------------------------ANENEKSTETDTKKPTK   540
WashU_Sbay_Contig677.12   524   ---------------------------------ANENEKSTETDTKKPTK   540
WashU_Scas_Contig555.6   507   STSNPTSAPSSASSSVSSSSMGSLVSASNATPPPQQSKEKTKQLDGQTSA   556
WashU_Sklu_Contig1620.2   402   ------------------------------------------VPKSKLAN   409
Symbols






: :



SGD_Scer_UBP3/YER151C   548   SKSFQHCATADAVKPDEFYKTLSTIPKFKDLQWGHQEDAEEFLTHLLDQL   597
MIT_Smik_c843_6269   545   SKNFHHNTTVEAVKPDEFYKTLSTIPKFKDLQWGHQEDAEEFLTHLLDQL   594
MIT_Suva_c368_6608   541   SKNFQHNATAEAVKPDEFYKTLSTIPKFKDLQWGHQEDAEEFLTHLLDQL   590
WashU_Sbay_Contig677.12   541   SKNFQHNATAEAVKPDEFYKTLSTIPKFKDLQWGHQEDAEEFLTHLLDQL   590
WashU_Scas_Contig555.6   557   TSETGITTSLPAIKPDDFYKILSTIPKFRDLQWGRQEDAEEFLTHLLDQL   606
WashU_Sklu_Contig1620.2   410   GNNVGITPAAEPIKPDDFYKTLSKLPKFRDLRWGHQEDAEEFLTHLLDQL   459
Symbols






.. .: .:***:*** **.:***:**:**:***************



SGD_Scer_UBP3/YER151C   598   HEELISAIDGLTDNEIQNMLQSINDEQLKVFFIRNLSRYGKAEFIKNASP   647
MIT_Smik_c843_6269   595   HEELISAIDGLTDNEIQNMLQSINDEQLKIFFIRNLSRYGKAEFIKNASP   644
MIT_Suva_c368_6608   591   HEELIFAIDGLSDNEIQNMLQSINDEQLKIFFIRNLSRYGKAEFIKNASP   640
WashU_Sbay_Contig677.12   591   HEELIFAIDGLSDNEIQNMLQSINDEQLKIFFIRNLSRYGKAEFIKNASP   640
WashU_Scas_Contig555.6   607   HEELVSSIDCLTDNEIQNLLQSINDESLKIFIVRNLPRYKKADFITNISP   656
WashU_Sklu_Contig1620.2   460   HEEFITSIDALNESDIMNLLQTINDEDLKGFFVRALSKYKTANFFKNCSA   509
Symbols






***:: :** *.:.:* *:**:****.** *::* *.:* .*:*:.* *.



SGD_Scer_UBP3/YER151C   648   RLKELIEKYGVINDDSTE--ENGWHEVSGSSKRGKKTKTAAKRTVEIVPS   695
MIT_Smik_c843_6269   645   RLKELIEKYGVINDDSTE--ENGWHEVSGSSKRGKKTKTAAKRTVEIVPS   692
MIT_Suva_c368_6608   641   RLKELIEKYGMISDDSTE--ENGWHEVSGSSKRGKKTKTAAKRTVEIVPS   688
WashU_Sbay_Contig677.12   641   RLKELIEKYGMISDDSTE--ENGWHEVSGSSKRGKKTKTAAKRTVEIVPS   688
WashU_Scas_Contig555.6   657   KLKELINKYGAANDDTSS--DNEWFEVSGSSKKGKKNKTAAKRTVEVIPS   704
WashU_Sklu_Contig1620.2   510   QMKGVMNKYGSNGEDDEEDCENEWHEVSSTSRKGKKTKSAAKRTVEVEVS   559
Symbols






::* :::*** .:* . :* *.***.:*::***.*:*******: *



SGD_Scer_UBP3/YER151C   696   PISKLFGGQFRSVLDIPNNKESQSITLDPFQTIQLDISDAGVNDLETAFK   745
MIT_Smik_c843_6269   693   PISKLFGGQFRSVLDIPNNKESQSITLDPFQTIQLDISDSSVNDLETAFK   742
MIT_Suva_c368_6608   689   PISKLFGGQFRSVLDIPNNKESQSITLDPFQTIQLDISDSSVNDLETAFK   738
WashU_Sbay_Contig677.12   689   PISKLFGGQFRSVLDIPNNKESQSITLDPFQTIQLDISDSSVNDLETAFK   738
WashU_Scas_Contig555.6   705   PISNLFGGQFRSVLDIPNNKESQSITLDPFQTIQLDISDPKVNDLESAFK   754
WashU_Sklu_Contig1620.2   560   PISSIFGGQFRSVLDIPKNKESQSITLDPFQTIQLDISDPAVNDLETAFK   609
Symbols






***.:************:*********************. *****:***



SGD_Scer_UBP3/YER151C   746   KFSEYELLPFKSSSGNDVEAKKQTFIDKLPQVLLIQFKRFSFINNVNKDN   795
MIT_Smik_c843_6269   743   KFSEYELLPFKSSSGNDVEAKKQTFIDKLPQVLLIQLKRFSFINNVNKDN   792
MIT_Suva_c368_6608   739   KFSEYELLPFKSSSGNDVEAKKQTFIDKLPQVLLIQFKRFSFINNVDKDN   788
WashU_Sbay_Contig677.12   739   KFSEYELLPFKSSSGNDVEAKKQTFIDKLPQVLLIQFKRFSFINNVDKDN   788
WashU_Scas_Contig555.6   755   QFSEYELLPFRTSNGTDVEAKKQTFIDKLPRVLLIQLKRFAFVTNSNKDS   804
WashU_Sklu_Contig1620.2   610   KFSEYELIPFKSSSGNDVEAKKQTFIDKLPQVLLIQLKRFSFINNTDKD-   658
Symbols






:******:**::*.*.**************:*****:***:*:.* :**



SGD_Scer_UBP3/YER151C   796   AMTNYNAYNGRIEKIRKKIKYGHELIIPEESMSSITLKNNTSGIDDRRYK   845
MIT_Smik_c843_6269   793   AMTNYNAYNGRIEKIRKKIKYDHELIIPEESMSSITLKNHTSGVDDRRYK   842
MIT_Suva_c368_6608   789   AMTNYNAYNGRIEKIRKKIKYGHELIIPEESMSSITLKNHATGIADRNYK   838
WashU_Sbay_Contig677.12   789   AMTNYNAYNGRIEKIRKKIKYGHELIIPEESMSSITLKNHATGIADRNYK   838
WashU_Scas_Contig555.6   805   NMSNYNAYSGRIEKIRKKIIYGHDLTIPIESVSSTSLR----DDANREYK   850
WashU_Sklu_Contig1620.2   659   KIVNYNAYSGRVEKIRKKIHYNHELTIPKETISSVHSN--FYDDAGTKYK   706
Symbols






: *****.**:******* *.*:* ** *::** . . . .**



SGD_Scer_UBP3/YER151C   846   LTGVIYHHGVSSDGGHYTADVYHSEHNKWYRIDDVNITELEDDDVLKGGE   895
MIT_Smik_c843_6269   843   LTGVIYHHGVSSDGGHYTADVYHKEHNKWYRIDDVNITELEDDDVLKGGE   892
MIT_Suva_c368_6608   839   LTGVIYHHGISSDGGHYTADVYHSEHNKWYRIDDVNIIELEDDDVLKGGE   888
WashU_Sbay_Contig677.12   839   LTGVIYHHGISSDGGHYTADVYHSEHNKWYRIDDVNIIELEDDDVLKGGE   888
WashU_Scas_Contig555.6   851   LTGVIYHHGSSPDGGHYTADVFHQQTNKWYRIDDVNISELKNDHVLDADD   900
WashU_Sklu_Contig1620.2   707   LVGVVYHHGVSPSGGHYTADVYHQEMDKWFRIDDVNIAELNKEEVLKGGE   756
Symbols






*.**:**** *..********:*.: :**:******* **:.:.**...:



SGD_Scer_UBP3/YER151C   896   EASDSRTAYILMYQKRN   912
MIT_Smik_c843_6269   893   EASDSRTAYILMYQKVY   909
MIT_Suva_c368_6608   889   EASDSRTAYILMYQKKN   905
WashU_Sbay_Contig677.12   889   EASDSRTAYILMYQKKN   905
WashU_Scas_Contig555.6   901   NDMGTRTAYILIYEKKN   917
WashU_Sklu_Contig1620.2   757   DGFDSRTAYILMYQKI-   772
Symbols






: .:******:*:*



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_UBP3/YER151C:

SGD_Scer_UBP3/YER151C  Length: 913  Mon Nov  7 15:17:09 2016  Type: P  Check: 9085  ..

       1  MNMQDANKEE SYSMYPKTSS PPPPTPTNMQ IPIYQAPLQM YGYTQAPYLY

      51  PTQIPAYSFN MVNQNQPIYH QSGSPHHLPP QNNINGGSTT NNNNINKKKW

     101  HSNGITNNNG SSGNQGANSS GSGMSYNKSH TYHHNYSNNH IPMMASPNSG

     151  SNAGMKKQTN SSNGNGSSAT SPSYSSYNSS SQYDLYKFDV TKLKNLKENS

     201  SNLIQLPLFI NTTEAEFAAA SVQRYELNMK ALNLNSESLE NSSVEKSSAH

     251  HHTKSHSIPK HNEEVKTETH GEEEDAHDKK PHASKDAHEL KKKTEVKKED

     301  AKQDRNEKVI QEPQATVLPV VDKKEPEESV EENTSKTSSP SPSPPAAKSW

     351  SAIASDAIKS RQASNKTVSG SMVTKTPISG TTAGVSSTNM AAATIGKSSS

     401  PLLSKQPQKK DKKYVPPSTK GIEPLGSIAL RMCFDPDFIS YVLRNKDVEN

     451  KIPVHSIIPR GIINRANICF MSSVLQVLLY CKPFIDVINV LSTRNTNSRV

     501  GTSSCKLLDA CLTMYKQFDK ETYEKKFLEN ADDAEKTTES DAKKSSKSKS

     551  FQHCATADAV KPDEFYKTLS TIPKFKDLQW GHQEDAEEFL THLLDQLHEE

     601  LISAIDGLTD NEIQNMLQSI NDEQLKVFFI RNLSRYGKAE FIKNASPRLK

     651  ELIEKYGVIN DDSTEENGWH EVSGSSKRGK KTKTAAKRTV EIVPSPISKL

     701  FGGQFRSVLD IPNNKESQSI TLDPFQTIQL DISDAGVNDL ETAFKKFSEY

     751  ELLPFKSSSG NDVEAKKQTF IDKLPQVLLI QFKRFSFINN VNKDNAMTNY

     801  NAYNGRIEKI RKKIKYGHEL IIPEESMSSI TLKNNTSGID DRRYKLTGVI

     851  YHHGVSSDGG HYTADVYHSE HNKWYRIDDV NITELEDDDV LKGGEEASDS

     901  RTAYILMYQK RN*

Protein Sequence for MIT_Smik_c843_6269:

MIT_Smik_c843_6269  Length: 910  Mon Nov  7 15:17:09 2016  Type: P  Check: 2621  ..

       1  MNMQDANKEE SYSMYPKTSS PPPPTPTNMQ IPIYQAPLQM YGYTQAPYLY

      51  PTQMPAYSFN MVNQNQPMYH QGNSPHHMPP QNSINGGNTT NSSNIGKKKW

     101  HSSSVANSSS NNGGSQGANS NGINYNKSHA YHHSYSNNHI PMMNSANNSN

     151  NVSMKKQANP SNGNGPSATS PSFSSYNSSS QYDLYKFDVT KLKNFKENSS

     201  SSVQLPLFIN TTEAEFATAS AQRYELNLKA LRLDPESLSE QPVAQSSVHH

     251  HAKIHDIPKH NEETKTETHG EEEDTHDKKS NASKDTHEHK RKIEQKEDES

     301  TLENSEQINQ EPRSTVAPIA VNKMEAEESI EESTLNTSSP TPPTAKSWSA

     351  IASDAIKSRQ ASNKPVSGSI MTKTSTSGTA TSASPTSTVT AAIGKSSSPL

     401  SSKQPQRKDK KYVPPSTKGI EPLGSIALRM CFDPDFISYV LRNKDIENKI

     451  PLHSIIPRGI VNRANICFMS SVLQVLLYCQ PFVDVLNVLS TRNTNSRIGT

     501  SSCKLLDACL TMYKQFDKEN YEKTMENAED TEKSSENDAK KPSKSKNFHH

     551  NTTVEAVKPD EFYKTLSTIP KFKDLQWGHQ EDAEEFLTHL LDQLHEELIS

     601  AIDGLTDNEI QNMLQSINDE QLKIFFIRNL SRYGKAEFIK NASPRLKELI

     651  EKYGVINDDS TEENGWHEVS GSSKRGKKTK TAAKRTVEIV PSPISKLFGG

     701  QFRSVLDIPN NKESQSITLD PFQTIQLDIS DSSVNDLETA FKKFSEYELL

     751  PFKSSSGNDV EAKKQTFIDK LPQVLLIQLK RFSFINNVNK DNAMTNYNAY

     801  NGRIEKIRKK IKYDHELIIP EESMSSITLK NHTSGVDDRR YKLTGVIYHH

     851  GVSSDGGHYT ADVYHKEHNK WYRIDDVNIT ELEDDDVLKG GEEASDSRTA

     901  YILMYQKVY*

Protein Sequence for MIT_Suva_c368_6608:

MIT_Suva_c368_6608  Length: 906  Mon Nov  7 15:17:09 2016  Type: P  Check: 7992  ..

       1  MNMQDTNKEE SYSMYPKTSS PPPPTPTNMQ IPIYQAPMQM YGYTQAPYLY

      51  PTQMPAYSLN MVTQNQAMYH QNTSPHYLPP QNNINTGSTN GSNSINKKKW

     101  HSNGPANNSN GQSANSNGSG VNYNKSHNYH HNYSNSHIPM MNTANNGNNM

     151  PVKKQANSSV ANGSTPSPSY NSSSQYDLFK FDVTKLKNFK ENSSNSIQLP

     201  LFINTTESEF AAASAQRYDL NLKSLNLESK SAEDQANTTT HHHRESHTLP

     251  KDGEKLEAEV EAEEVDKEGK DVDDKKPSAS KDNREHKRKI EPKKDDTEKE

     301  QGEGAISETY PASEGLPVVG NEELEETADE DTTKASSSPT LPTAKSWSAI

     351  ASDAIKSRQA SNKSASGSTI SQTSASTTAT SAPLSTAATA KSNSPLSSKQ

     401  PQRKDKKYVP PSTKGIEPLG SIALRMCFDP DFISYVLQNK DTENKIPLHS

     451  IIPRGIINRA NICFMSSVLQ VLLYCQPFID VLNVLSTRNT NSRIGTSSCR

     501  LLDACLTMYK QFDVETYEKS LESANENEKS TETDTKKPTK SKNFQHNATA

     551  EAVKPDEFYK TLSTIPKFKD LQWGHQEDAE EFLTHLLDQL HEELIFAIDG

     601  LSDNEIQNML QSINDEQLKI FFIRNLSRYG KAEFIKNASP RLKELIEKYG

     651  MISDDSTEEN GWHEVSGSSK RGKKTKTAAK RTVEIVPSPI SKLFGGQFRS

     701  VLDIPNNKES QSITLDPFQT IQLDISDSSV NDLETAFKKF SEYELLPFKS

     751  SSGNDVEAKK QTFIDKLPQV LLIQFKRFSF INNVDKDNAM TNYNAYNGRI

     801  EKIRKKIKYG HELIIPEESM SSITLKNHAT GIADRNYKLT GVIYHHGISS

     851  DGGHYTADVY HSEHNKWYRI DDVNIIELED DDVLKGGEEA SDSRTAYILM

     901  YQKKN*

Protein Sequence for WashU_Sbay_Contig677.12:

WashU_Sbay_Contig677.12  Length: 906  Mon Nov  7 15:17:09 2016  Type: P  Check: 7992  ..

       1  MNMQDTNKEE SYSMYPKTSS PPPPTPTNMQ IPIYQAPMQM YGYTQAPYLY

      51  PTQMPAYSLN MVTQNQAMYH QNTSPHYLPP QNNINTGSTN GSNSINKKKW

     101  HSNGPANNSN GQSANSNGSG VNYNKSHNYH HNYSNSHIPM MNTANNGNNM

     151  PVKKQANSSV ANGSTPSPSY NSSSQYDLFK FDVTKLKNFK ENSSNSIQLP

     201  LFINTTESEF AAASAQRYDL NLKSLNLESK SAEDQANTTT HHHRESHTLP

     251  KDGEKLEAEV EAEEVDKEGK DVDDKKPSAS KDNREHKRKI EPKKDDTEKE

     301  QGEGAISETY PASEGLPVVG NEELEETADE DTTKASSSPT LPTAKSWSAI

     351  ASDAIKSRQA SNKSASGSTI SQTSASTTAT SAPLSTAATA KSNSPLSSKQ

     401  PQRKDKKYVP PSTKGIEPLG SIALRMCFDP DFISYVLQNK DTENKIPLHS

     451  IIPRGIINRA NICFMSSVLQ VLLYCQPFID VLNVLSTRNT NSRIGTSSCR

     501  LLDACLTMYK QFDVETYEKS LESANENEKS TETDTKKPTK SKNFQHNATA

     551  EAVKPDEFYK TLSTIPKFKD LQWGHQEDAE EFLTHLLDQL HEELIFAIDG

     601  LSDNEIQNML QSINDEQLKI FFIRNLSRYG KAEFIKNASP RLKELIEKYG

     651  MISDDSTEEN GWHEVSGSSK RGKKTKTAAK RTVEIVPSPI SKLFGGQFRS

     701  VLDIPNNKES QSITLDPFQT IQLDISDSSV NDLETAFKKF SEYELLPFKS

     751  SSGNDVEAKK QTFIDKLPQV LLIQFKRFSF INNVDKDNAM TNYNAYNGRI

     801  EKIRKKIKYG HELIIPEESM SSITLKNHAT GIADRNYKLT GVIYHHGISS

     851  DGGHYTADVY HSEHNKWYRI DDVNIIELED DDVLKGGEEA SDSRTAYILM

     901  YQKKN*

Protein Sequence for WashU_Scas_Contig555.6:

WashU_Scas_Contig555.6  Length: 918  Mon Nov  7 15:17:09 2016  Type: P  Check: 6807  ..

       1  MSETKEESTS MYPPTNSPPQ PQANMHFPVH YQATAPMQMY PFQSPYMYGQ

      51  QPAYAFNMVN QNQMMYQNNA GGMPTQGGGN GFNGSKKKYG NNSNMGSKTH

     101  NYHQNANSPS YTPTYHSTSN NNLNTHSKRS HSNYNNSTDS TGTTTPSYDP

     151  FRFDVSKLTV TKTLEFPLFV NANQKDYIRA RSKRREVRLK TINSVKEINL

     201  DINEEEKITE PPKEAEKKVE QKLEPQVEIV SKKDKADEVP KPEKETETKK

     251  SSTVTIEKDK AKRSSTPATP KPVLEVVPTE SKKKEKENRT KKEESEVALN

     301  LPSPEEKSSA DVVVPTTPAA TKAPTPMLWA AVASGGISKV KQASSSSKNL

     351  TSTKGAPASV SKSSRSPNAL AQAPQKKDSK YVPPSTKGAE SLGSIALRMC

     401  FDPDFINYTL KTKQNSNVDR TIPIKSIIPR GIVNMANICF MSSVLQVLLY

     451  CKPFIDILNV ISTRNMYSRV GVSSSRLLDA CVNLYKQFDK ETVEAQQKEM

     501  EESKSLSTSN PTSAPSSASS SVSSSSMGSL VSASNATPPP QQSKEKTKQL

     551  DGQTSATSET GITTSLPAIK PDDFYKILST IPKFRDLQWG RQEDAEEFLT

     601  HLLDQLHEEL VSSIDCLTDN EIQNLLQSIN DESLKIFIVR NLPRYKKADF

     651  ITNISPKLKE LINKYGAAND DTSSDNEWFE VSGSSKKGKK NKTAAKRTVE

     701  VIPSPISNLF GGQFRSVLDI PNNKESQSIT LDPFQTIQLD ISDPKVNDLE

     751  SAFKQFSEYE LLPFRTSNGT DVEAKKQTFI DKLPRVLLIQ LKRFAFVTNS

     801  NKDSNMSNYN AYSGRIEKIR KKIIYGHDLT IPIESVSSTS LRDDANREYK

     851  LTGVIYHHGS SPDGGHYTAD VFHQQTNKWY RIDDVNISEL KNDHVLDADD

     901  NDMGTRTAYI LIYEKKN*

Protein Sequence for WashU_Sklu_Contig1620.2:

WashU_Sklu_Contig1620.2  Length: 773  Mon Nov  7 15:17:09 2016  Type: P  Check: 4756  ..

       1  MTDSNPKDNK QDQSSYSMYP PTSPVAPPAN MQYNINMYGN PAAAAAFAQY

      51  GYGYPMPMDV YAGQGAPFMG YGMNPNMMYY GNGNGNVPQQ NPKKKYYNNN

     101  SNNINNNNNT NSIGSNTSNN ISSISTPLNN SKTATSSVTS TGTSTPVSKP

     151  VSIVIKNQYK FELGNSNSFS TKNLKLEYPF YVNTDEAEFE QARSKRHFLR

     201  LQALNDEIST PTADAEAEID EATVPLDEGI VEDGPKKEKP SKESPKEDLN

     251  EAPSPKSVKS WSAIASSAVS KPKVSLSPTP QLKKDKKYVP STIKSLEPLG

     301  VVALRMCLDQ DYIKYTIENV PNAGNAIDSI VPRGIVNTGN ICFMSSVLQV

     351  LLYCKPFISI LNVISYRTVA KIGSSVSPSL DACLELYRRF DKQTCENEKK

     401  PVPKSKLANG NNVGITPAAE PIKPDDFYKT LSKLPKFRDL RWGHQEDAEE

     451  FLTHLLDQLH EEFITSIDAL NESDIMNLLQ TINDEDLKGF FVRALSKYKT

     501  ANFFKNCSAQ MKGVMNKYGS NGEDDEEDCE NEWHEVSSTS RKGKKTKSAA

     551  KRTVEVEVSP ISSIFGGQFR SVLDIPKNKE SQSITLDPFQ TIQLDISDPA

     601  VNDLETAFKK FSEYELIPFK SSSGNDVEAK KQTFIDKLPQ VLLIQLKRFS

     651  FINNTDKDKI VNYNAYSGRV EKIRKKIHYN HELTIPKETI SSVHSNFYDD

     701  AGTKYKLVGV VYHHGVSPSG GHYTADVYHQ EMDKWFRIDD VNIAELNKEE

     751  VLKGGEDGFD SRTAYILMYQ KI*