Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YER105C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_NUP157/YER105C   1   --MYSTPLKKRIDYDRETFTASASLGGNRLRNRPRDDQNNGKPNLSSRSF   48
MIT_Smik_c620_6467   1   --MYSTPLKKRVDYDHETFTVANSLGRNRSQNQLRDDPDQGKLNLSGSSF   48
MIT_Spar_c333_6591   1   --MYSTPLKKRVDYDRETFTVPASLGRDRLQNQLRDDQNKGKLNLSSISF   48
MIT_Suva_c371_6839   1   --MYSTPLKKRVDYDREAFKFPGTSGQNHLPDRLRDGQGQHNPNLSNSPL   48
WashU_Sbay_Contig677.56   1   --MYSTPLKKRVDYDREAFKFPGTSGQNHLPDRLRDGQGQHNPNLSNSPL   48
WashU_Sklu_Contig2332.4   1   MSIFSTPLKSGIDYNSSLVATANRNTDINPISVPTQTTATTVLTGSYN--   48
WashU_Smik_Contig2834.3   1   --MYSTPLKKRVDYDHETFTVANSLGRNRSQNQLRDDPDQGKLNLSGSSF   48
Symbols






::*****. :**: . . . . . : . *



SGD_Scer_NUP157/YER105C   49   LSERKTRKDVLNKYGEAGNTIESELRDVTTHVKISGLTSSEPLQLASEFV   98
MIT_Smik_c620_6467   49   QTKKSTNNNIMNNCGEMGSTVESELHDVNTHVKVSGLASSEPLQLASEFV   98
MIT_Spar_c333_6591   49   PSKKPTRKDVLDKYSEAGNTIEPEFHDVTTHVKVSGLTSSEPLQLASEFV   98
MIT_Suva_c371_6839   49   QTSR------LDNNIQQKYGEAANTVDINTHVEVSGFTSSDPLQLASGFV   92
WashU_Sbay_Contig677.56   49   QTSR------LDNNIQQKYGEAANTVDINTHVEVSGFTSSDPLQLASGFV   92
WashU_Sklu_Contig2332.4   49   -----------------ALAANTLPSHGNEHIHVNGLGTLRPLELASQYV   81
WashU_Smik_Contig2834.3   49   QTKKSTNNNIMNNCGEMGSTVESELHDVNTHVKVSGLASSEPLQLASEFV   98
Symbols






. . . *:.:.*: : **:*** :*



SGD_Scer_NUP157/YER105C   99   QDLSFRDRNTPILDNPDYYSKGLDYNFSDEVGGLGAFTPFQRQQVTNIPD   148
MIT_Smik_c620_6467   99   QDLNFRDKNTPVLDNADYCRKGVDYNFSDEVGGLGAFTPFQRRQVINIPD   148
MIT_Spar_c333_6591   99   QDLNFRDRNTPILDNSAYYRKGVDYNFSDEVGGLGAFTPFQRQQVTNIPD   148
MIT_Suva_c371_6839   93   QDLSLGDRSTPVLDSPSYYRSGVNYNFTNEVGGLGAFTPFQRQQVTNIPD   142
WashU_Sbay_Contig677.56   93   QDLSLGDRSTPVLDSPSYYRSGVNYNFTNEVGGLGAFTPFQRQQVTNIPD   142
WashU_Sklu_Contig2332.4   82   DSLQRRDSSTPILDERSYYNGGVTYNFSKEVGGLGAFTPFERTQVINIPD   131
WashU_Smik_Contig2834.3   99   QDLNFRDKNTPVLDNADYCRKGVDYNFSDEVGGLGAFTPFQRRQVINIPD   148
Symbols






:.*. * .**:**. * *: ***:.***********:* ** ****



SGD_Scer_NUP157/YER105C   149   EVLSQVSNTEIKSDMGIFLELNYCWITSDNKLILWNINNSSEYHCIDEIE   198
MIT_Smik_c620_6467   149   EVLLEVSSTEIKSDMGIFPELNFCWITSDNKLILWNINNSSEFHCIDEIE   198
MIT_Spar_c333_6591   149   EVLLEVSNTEIKSDMGMFLELNYCWITSDNKLILWNINNSSEFHCIDEIE   198
MIT_Suva_c371_6839   143   EVVSEVSSTEIKSDMGIFPELGYCWITSDNKLILWNINNSSEFHCIDEIE   192
WashU_Sbay_Contig677.56   143   EVVSEVSSTEIKSDMGIFPELGYCWITSDNKLILWNINNSSEFHCIDEIE   192
WashU_Sklu_Contig2332.4   132   EILQEASKTEIKSDMGIFPELERCWITIDNKLILWNIKDTSDFQAIDDIK   181
WashU_Smik_Contig2834.3   149   EVLLEVSSTEIKSDMGIFPELNFCWITSDNKLILWNINNSSEFHCIDEIE   198
Symbols






*:: :.*.********:* ** **** *********:::*:::.**:*:



SGD_Scer_NUP157/YER105C   199   HTILKVKLVKPSPNTFVSSVENLLIVATLFDIYILTISFNDRTHELNIFN   248
MIT_Smik_c620_6467   199   HTILKVKLVKPRQKTFVSSVENLLIVATLFDIYILTISFDDLTHELNISN   248
MIT_Spar_c333_6591   199   HTILKVKLVKPRPNTFVSSVENLLIVATLFDIYILTISFDDHTHELNIFN   248
MIT_Suva_c371_6839   193   HTILKVKLVKPRSNTFVSSVENLLIVATLFDIYILTISFDSTTHKLNIFN   242
WashU_Sbay_Contig677.56   193   HTILKVKLVKPRSNTFVSSVENLLIVATLFDIYILTISFDSTTHKLNIFN   242
WashU_Sklu_Contig2332.4   182   HTILKVALVKPKPKTFVDNINHLLLIATPFDIYLLAISFNETTGELEVFN   231
WashU_Smik_Contig2834.3   199   HTILKVKLVKPRQKTFVSSVENLLIVATLFDIYILKISFDDLTHELNISN   248
Symbols






****** **** :***..:::**::** ****:* ***:. * :*:: *



SGD_Scer_NUP157/YER105C   249   TGLKVNVTGFNVSNIISYERTGQIFFTGATDGVNVWELQYNCSENLFNSK   298
MIT_Smik_c620_6467   249   TGLKVNATGLNVSNIINYEKTGQIFFTGSTDGVNVWELQYNCSENLFNSK   298
MIT_Spar_c333_6591   249   TGLKVNVTGFNVSNIISYERTGQVFFTGSTDSVNVWELQYNCSENLFNSK   298
MIT_Suva_c371_6839   243   TGLKVNATGLNVSNITNYEKTGQIFFTGSSDGVNVWELQYNCSENLFNSK   292
WashU_Sbay_Contig677.56   243   TGLKVNATGLNVSNITNYEKTGQIFFTGSSDGVNVWELQYNCSENLFNSK   292
WashU_Sklu_Contig2332.4   232   TGICVSVHGLDVSEIIFYEKTGQVFFAGKSNGINVWELQYSSSEDWFNSK   281
WashU_Smik_Contig2834.3   249   TGLKVNATGLNVSNIINYEKTGQIFFTGSTDGVNVWELQYNCSENLFNSK   298
Symbols






**: *.. *::**:* **:***:**:* ::.:*******..**: ****



SGD_Scer_NUP157/YER105C   299   SNKICLTKSNLANLLPTKLIPSIPGGKLIQKVLEGDAGTEEETISQLEVD   348
MIT_Smik_c620_6467   299   CDKICLTKSSLANLLPTRLIPNVPGGKLIQRVLEGDDEVGEETILQLDLD   348
MIT_Spar_c333_6591   299   CNKICLTKSSFANLLPTKLIPSMPGGKLIQKVLEGDSGAEEETISQLDID   348
MIT_Suva_c371_6839   293   CSKVCLTKSNLANLLPTRLISGVPGSKMIQRVLEGDVNVGEETILQLIVD   342
WashU_Sbay_Contig677.56   293   CSKVCLTKSNLANLLPTRLISGVPGSKMIQRVLEGDVNVGEETILQLIVD   342
WashU_Sklu_Contig2332.4   282   CNKVCLTQSTLSSLLPTNIISKLPGSNLLQSFFEEDSQYSQETIIQLSVD   331
WashU_Smik_Contig2834.3   299   CNKICLTKSSLANLLPTRLIPNVPGGKLIQRVLEGDDEVGEETILQLDLD   348
Symbols






..*:***:*.::.****.:*. :**.:::* .:* * :*** ** :*



SGD_Scer_NUP157/YER105C   349   QSRGVLHTLSTKSIVRSYLITSNGLVGPVLIDAAHIRRGMNALGVKNSPL   398
MIT_Smik_c620_6467   349   QSRGILHTLSTKSIIRSYLITNNGLESPAMIDAPHIRRSISAFGLKDSPL   398
MIT_Spar_c333_6591   349   QSRGVLHTLSTKSIVRSYLITSNGLEGPVLIDIPHIRRSISALGIKDSPL   398
MIT_Suva_c371_6839   343   QSRGVLHTLSTKSIVRSYLITSDGLEGPVLIDAPHIRRSLGALDAKDSPL   392
WashU_Sbay_Contig677.56   343   QSRGVLHTLSTKSIVRSYLITSDGLEGPVLIDAPHIRRSLGALDAKDSPL   392
WashU_Sklu_Contig2332.4   332   QSRGVLYSLSSKSVVRAYKINGKSLDGPMTIEPSYIRRIIGTTTARGAAI   381
WashU_Smik_Contig2834.3   349   QSRGILHTLSTKSIIRSYLITNNGLESPAMIDAPHIRRSISAFGLKDSPL   398
Symbols






****:*::**:**::*:* *....* .* *: .:*** :.: :.:.:



SGD_Scer_NUP157/YER105C   399   LSNRAFKIAKIVSISMCENNDLFLAVITTTGVRLYFKGSISRRSIGSLKL   448
MIT_Smik_c620_6467   399   LTNRAFKIAKIVSISKWESNDLFLAVITTSGVRLYLKGITSKRSIGSLKL   448
MIT_Spar_c333_6591   399   LSSRAFKIARIVSISKRENNDLFLAVITTTGVRLYFKGFTSRRSIGSLKL   448
MIT_Suva_c371_6839   393   LTSRLLKIVKIIPISKWENNDIFLALITTAGVRLYFKGSTSKRSIGSLKL   442
WashU_Sbay_Contig677.56   393   LTSRLLKIVKIIPISKWENNDIFLALITTAGVRLYFKGSTSKRSIGSLKL   442
WashU_Sklu_Contig2332.4   382   LGNKYLKISKIVVVSEHENNNLFLVAITIGGVRLYFNGSLNRTNVEALRL   431
WashU_Smik_Contig2834.3   399   LTNRAFKIAKIVSISKWESNDMFLAVITTSGVRLYLKGITSKRSIGSLKL   448
Symbols






* .: :** :*: :* *.*::**. ** *****::* .: .: :*:*



SGD_Scer_NUP157/YER105C   449   DSVKFPPTSISSSLEQNKSFIIGHH-------PLNTHDTGPLSTQKASST   491
MIT_Smik_c620_6467   449   DFLKLPPTCLFNSFVKNDFSTVNHS-------HLYSKDKSLISAQKASSV   491
MIT_Spar_c333_6591   449   DFLKFPPTSISNSLEKKKFSIVNQK-------HLYTQDICPLSAQKASST   491
MIT_Suva_c371_6839   443   VSLKCPPANSSDKFQKNGFSAVNQK-------PLYTKSPSPLSAQKKSSV   485
WashU_Sbay_Contig677.56   443   VSLKCPPANSSDKFQKNGFSAVNQK-------PLYTKSPSPLSAQKKSSV   485
WashU_Sklu_Contig2332.4   432   ESIKFPPSSITPDAIEQEFQQQQQKKLMPFYSSLNSSESIQLKYQKKSSV   481
WashU_Smik_Contig2834.3   449   DFLKLPPTCLFNSFVKNDFSTVNHS-------HLYSKDKSLISAQKASSV   491
Symbols






:* **: . :: : * : . :. ** **.



SGD_Scer_NUP157/YER105C   492   YINTTCASTIISPGIYFTCVRKR--ANSGELSKGITNKALLENKEEHKLY   539
MIT_Smik_c620_6467   492   YINTSYASTIISPGIYFTSVTKP--SNFGELSNDNARKDGQEKREEHKLY   539
MIT_Spar_c333_6591   492   YINTTCASTIISPGIYFTSVKKR--NNSGESSNSIARRNQLENKEEHKLY   539
MIT_Suva_c371_6839   486   YIDTTDASTIISPGIYFTSVRGT--NNSEDLSNNFSHIHMLEKKEECKLY   533
WashU_Sbay_Contig677.56   486   YIDTTDASTIISPGIYFTSVRGT--NNSEDLSNNFSHIHMLEKKEECKLY   533
WashU_Sklu_Contig2332.4   482   LLESTKASTIISPGIFFSAVVKTNLQDPSKQPTNQQKQQQQQQQQQNRLF   531
WashU_Smik_Contig2834.3   492   YINTSYASTIISPGIYFTSVTKP--SNFGELSNDNARKDGQEKREEHKLY   539
Symbols






:::: *********:*:.* : . ... . ::::: :*:



SGD_Scer_NUP157/YER105C   540   VSAPDYGILKNYGKYVENTALLDTTDEIKEIVPLTRSFNYTSTPQGYANV   589
MIT_Smik_c620_6467   540   VSAPDYGLLKNYGKYVENTVLLDTTDEIKEIVPLTRCFNYTSTPQGYANV   589
MIT_Spar_c333_6591   540   VSVPDYGILKNYGKYVENTTLLDTTDEVKEIVPLTRCFNYTSTPQGYANF   589
MIT_Suva_c371_6839   534   VSVPDYGILKNHGKYVENTALLDTTDEIKEIVSLTKFFNYTSTPQGYANA   583
WashU_Sbay_Contig677.56   534   VSVPDYGILKNHGKYVENTALLDTTDEIKEIVSLTKFFNYTSTPQGYANA   583
WashU_Sklu_Contig2332.4   532   VTVPDYGILKNHGKYVENACFLDTTSSIKEIVSITPSFNATNKPEGYANE   581
WashU_Smik_Contig2834.3   540   VSAPDYGLLKNYGKYVENTVLLDTTDEIKEIVPLTRCFNYTSTPQGYANV   589
Symbols






*:.****:***:******: :****..:****.:* ** *..*:****



SGD_Scer_NUP157/YER105C   590   FASQYSAEPLKVAVLTSNALEIYCYRTPDEVFESLIENPLPFIHSYGLSE   639
MIT_Smik_c620_6467   590   FASQYNVEPLKVAVLTSNALEIYCYRTPDEVFESLIENPLPFIHKYGLSE   639
MIT_Spar_c333_6591   590   FASQYNVEPLKVAVLTSNALEIYCYRTPDEVFESLIENPLPFIRSYGLSE   639
MIT_Suva_c371_6839   584   FASQYNAEPLKIAVLTSNAVEIYGYRRPDEIFESLIENPLPFIHNYGLSE   633
WashU_Sbay_Contig677.56   584   FASQYNAEPLKIAVLTSNAVEIYGYRRPDEIFESLIENPLPFIHNYGLSE   633
WashU_Sklu_Contig2332.4   582   FATQYSTESFKVAVLTNNSVEIYRYRTPDQVFESVIENPLPFVMNYGLAE   631
WashU_Smik_Contig2834.3   590   FASQYNVEPLKVAVLTSNALEIYCYRTPDEVFESLIENPLPFIHKYGLSE   639
Symbols






**:**..*.:*:****.*::*** ** **::***:*******: .***:*



SGD_Scer_NUP157/YER105C   640   ACSTALYLACKFNKSEHIKSSALAFFSAGIPGVVEIKPKSSRESGSVPPI   689
MIT_Smik_c620_6467   640   ACSTALYLACKFNKSEYVKAGALAFFSAGIPGVVEIKPKDSRDSGCLLQI   689
MIT_Spar_c333_6591   640   ACSTALYLACKFNKSEHIKASALAFFSAGIPGIVEIKPKNSRDSSSVPPI   689
MIT_Suva_c371_6839   634   ACSTALYLTCRFNKSEHVKASALGFLLAGIPGVVEIKPQYLRDSGSLSSI   683
WashU_Sbay_Contig677.56   634   ACSTALYLTCRFNKSEHVKASALGFLLAGIPGVVEIKPQYLRDSGSLSSI   683
WashU_Sklu_Contig2332.4   632   ACSSALFVTCKFNKSESLRSSALTFFTVGIPGVVEIKPRYNSYSTSAVSS   681
WashU_Smik_Contig2834.3   640   ACSTALYLACKFNKSEYVKAGALAFFSAGIPGVVEIKPKDSRDSGCLLQI   689
Symbols






***:**:::*:***** :::.** *: .****:*****: * .



SGD_Scer_NUP157/YER105C   690   SQNLFDKSGEC------------------------------DGIVLSPRF   709
MIT_Smik_c620_6467   690   AQKKLAKFSES------------------------------DDIVLSPRF   709
MIT_Spar_c333_6591   690   AQKILDKSGEG------------------------------DNIVLSPRF   709
MIT_Suva_c371_6839   684   TPETPNKFDDG------------------------------NGIALSPRF   703
WashU_Sbay_Contig677.56   684   TPETPNKFDDG------------------------------NGIALSPRF   703
WashU_Sklu_Contig2332.4   682   LLSKTNITMTPQKSLLNVSTGDVSRIPTSAGSTVVNGNYNLDNVILSPRF   731
WashU_Smik_Contig2834.3   690   AQKKLAKFSES------------------------------DDIVLSPRF   709
Symbols






. :.: *****



SGD_Scer_NUP157/YER105C   710   YGSALLITRLFSQIWEERVFVFK------------RASKTEKMDAFGISI   747
MIT_Smik_c620_6467   710   YGSALLITRLFSQIWEDKIFIFR------------KVSRADKSNMFGISI   747
MIT_Spar_c333_6591   710   YGSALLITRLFCQIWEEKVFVFR------------RASKAEKSNIFGISI   747
MIT_Suva_c371_6839   704   YGSALLVTRLLSQIWEEKVFTSK------------MIPKTTN--MFGISI   739
WashU_Sbay_Contig677.56   704   YGSALLVTRLLSQIWEEKVFTSK------------MIPKTTN--MFGISI   739
WashU_Sklu_Contig2332.4   732   YGIALLITRLFRDIWDKPVFSVNSNAKYDTKLQLIKESVPNGDLIKLVSI   781
WashU_Smik_Contig2834.3   710   YGSALLITRLFSQIWEDKIFIFR------------KVSRADKSNMFGISI   747
Symbols






** ***:***: :**:. :* . . . :**



SGD_Scer_NUP157/YER105C   748   TRPQVEYYLSSISVLADFFNIHRPSFVSFVPPKGSN---------AITAS   788
MIT_Smik_c620_6467   748   TRPQVEYYLSSISVLADFFKNHHSSFVSFVDPKNSD---------AITAS   788
MIT_Spar_c333_6591   748   TRPQVEYYLSSISVLADFFNIHRPSFVSFVSPKDSN---------TITAS   788
MIT_Suva_c371_6839   740   TRLQVEYYLSSISVLADFFNIHRSSFVSFLTPSDAN---------VLTAS   780
WashU_Sbay_Contig677.56   740   TRLQVEYYLSSISVLADFFNIHRSSFVSFLTPSDAN---------VLTAS   780
WashU_Sklu_Contig2332.4   782   SKSDVEYYLSSIMILNEFFNSYGNSISTISTPSFQNNGGRSTDRSEEVSN   831
WashU_Smik_Contig2834.3   748   TRPQVEYYLSSISVLADFFKNHHSSFVSFVDPKNSD---------AITVS   788
Symbols






:: :******** :* :**: : *: :: *. : . .



SGD_Scer_NUP157/YER105C   789   DAESIAMNALILLINSIKDALSLINVFYED--IDAFKSLLNTLMGAGGVY   836
MIT_Smik_c620_6467   789   DAESIAMNSLILLINSIKDALSLLNVFYED--IDTFKSLLNTLMGEGGIY   836
MIT_Spar_c333_6591   789   DAESIAMNALILLINSIKDALSLLNVFYED--IDAFKSLLNTLMGEGGVY   836
MIT_Suva_c371_6839   781   DAESIAMEALILLVNSIKDALSLLNVFYEE--IDAFKSLLYTLMGERGIY   828
WashU_Sbay_Contig677.56   781   DAESIAMEALILLVNSIKDALSLLNVFYEE--IDAFKSLLYTLMGERGIY   828
WashU_Sklu_Contig2332.4   832   QAESIAINALIKLVQSMKEALSFLNVLFEESDVDGYEGQYLAFKDIMKFL   881
WashU_Smik_Contig2834.3   789   DAESIAMNSLILLINSIKDALSLLNVFYED--IDTFKSLLNTLMGEGGIY   836
Symbols






:*****:::** *::*:*:***::**::*: :* ::. :: . .



SGD_Scer_NUP157/YER105C   837   DSKTREYFFDLKFHDLFTPNAKTKQLIKEILIEVVNANIASGTSADYIVN   886
MIT_Smik_c620_6467   837   DSKTREYFLNLEFHDLFTPNIETKQVIKEILIEIVNANIANGAPADYIMN   886
MIT_Spar_c333_6591   837   DSKTREYFFSLHFHDLFTPNTETKQLIKEILIEVVNANIASGAPADYIMN   886
MIT_Suva_c371_6839   829   DSKTRDYFFNLRFHDLFTPNTETKQIVKEILIEIVNANITRGASADYIMN   878
WashU_Sbay_Contig677.56   829   DSKTRDYFFNLRFHDLFTPNTETKQIVKEILIEIVNANITRGASADYIMN   878
WashU_Sklu_Contig2332.4   882   NLDIQIDLTKLRFKDIFAPDEQAKNLVREILSSIINRNISKGGSIEYIAT   931
WashU_Smik_Contig2834.3   837   DSKTREYFLNLEFHDLFTPNIETKQVIKEILIEIVNANIANGAPADYIMN   886
Symbols






: . : : .*.*:*:*:*: ::*::::*** .::* **: * . :** .



SGD_Scer_NUP157/YER105C   887   VLKERFGSFCHSADILCYRAGEHLEAAQKFEMIDSKISRNHLDTAIDLYE   936
MIT_Smik_c620_6467   887   VFKERFGSFCHGADILCYRAGEHLEAAQKFEIIDSKISRNHLDTAIDFYE   936
MIT_Spar_c333_6591   887   VLKERFGSFCHGADILCYRAGEHLEAAQKFEIIDSKISRNHLDTAIDLYE   936
MIT_Suva_c371_6839   879   VLKERCGSFCSGTDILCFRAGEHLEAAQKFEMVDSKLSRNHLDSAVDLYE   928
WashU_Sbay_Contig677.56   879   VLKERCGSFCSGTDILCFRAGEHLEAAQKFEMVDSKLSRNHLDSAVDLYE   928
WashU_Sklu_Contig2332.4   932   ALQERCGSFCSSGDVLGFRAVEHLRKAKEIGLRDYETLNYHLTNATKLFE   981
WashU_Smik_Contig2834.3   887   VFKERFGSFCHGADILCYRAGEHLEAAQKFEIIDSKISRNHLDTAIDFYE   936
Symbols






.::** **** . *:* :** ***. *::: : * : . ** .* .::*



SGD_Scer_NUP157/YER105C   937   RCAENIELCELRRVVDIMVKLNYQPKTVGFLLRFADKIDKGNQAQEYVSR   986
MIT_Smik_c620_6467   937   RCAENIKLDELRNIVNMMVKLDYQPRTVEFLLKVADKIDKANQAQEYVSG   986
MIT_Spar_c333_6591   937   RCADNIELNELRRIVDIMVKLNYQPRTVEFLLRVADKIDKANQAQEYVSE   986
MIT_Suva_c371_6839   929   RCAESMEINELKRIVDVMVKLNYQPRTVEFLLRVADGIDKENQAQGYAAE   978
WashU_Sbay_Contig677.56   929   RCAESMEINELKRIVDVMVKLNYQPRTVEFLLRVADGIDKENQAQGYAAE   978
WashU_Sklu_Contig2332.4   982   KIVNDISVDKLKEAVTIMLDLNYYPKTIEFLLNIANSIDKGKLAYQYVAC   1031
WashU_Smik_Contig2834.3   937   RCAENIKLDELRNIVNMMVKLDYQPRTVEFLLKVADKIDKANQAQEYVSG   986
Symbols






: .:.:.: :*:. * :*:.*:* *:*: ***..*: *** : * *.:



SGD_Scer_NUP157/YER105C   987   GCNTADPRKVFYDKRINVYTLIFEIVKSVDDYTSIEQSPSIANISIFSPA   1036
MIT_Smik_c620_6467   987   GCKIDDPRRVFYNKRVDVYKIIFDILKSVDDNTSIEQSVPAKNIAISSPA   1036
MIT_Spar_c333_6591   987   GSKIADPRKDFYDKRINVYTLIFDIVKSVDDNTPAEQSPSIANISISSPA   1036
MIT_Suva_c371_6839   979   GCRINDPRKKFYEKRISVYNLIFDILKTVDENTSVEQSSSVGKITISSPA   1028
WashU_Sbay_Contig677.56   979   GCRINDPRKKFYEKRISVYNLIFDILKTVDENTSVEQSSSVGKITISSPA   1028
WashU_Sklu_Contig2332.4   1032   RMFRAX--------------------------------------------   1037
WashU_Smik_Contig2834.3   987   GCKIDDPRRVFYNKRVDVYKIIFDILKSVDDNTSIEQSVPAKNIAISSPA   1036
Symbols










SGD_Scer_NUP157/YER105C   1037   SSLKKRVYSVIMNSNNRFFHYCFYDWLVANKRQDYLLRLDSQFVLPYLKE   1086
MIT_Smik_c620_6467   1037   LSLKESIYSVIINSNNRLFHYCFYDWLVANKRQDGLLQLDSQFVLPYLKE   1086
MIT_Spar_c333_6591   1037   LSLKERVYSVMMNSSNRFFHYCFYDWLVANKRQDDLLQLHSQFVLPYLKE   1086
MIT_Suva_c371_6839   1029   MSLKERVYSMILNSNNRFFHYCFYDWLVQNGREDDLLQLDSQFVLSYLKE   1078
WashU_Sbay_Contig677.56   1029   MSLKERVYSMILNSNNRFFHYCFYDWLVQNGREDDLLQLDSQFVLSYLKE   1078
WashU_Sklu_Contig2332.4   
   --------------------------------------------------   
WashU_Smik_Contig2834.3   1037   LSLKESIYSVIINSNNRLFHYCFYDWLVANKRQDGLLQLDSQFVLPYLKE   1086
Symbols










SGD_Scer_NUP157/YER105C   1087   RAEKSLEISNLLWFYLFKEEHFLEAADVLYALASSDFDLKLSERIECLAR   1136
MIT_Smik_c620_6467   1087   RAEKSLEISNLLWLYLSKEECFFEAAAVLYALASSDFDLKLSERIECLAR   1136
MIT_Spar_c333_6591   1087   KAEKSLEICNLLWFYLSKEEHFLEAADVLYALASADFDLKLSERIECLAR   1136
MIT_Suva_c371_6839   1079   KAEKSLEASNLLWIYLSKKEHFFEAATVLYALANSDFDLTLNDRIECLAR   1128
WashU_Sbay_Contig677.56   1079   KAEKSLEASNLLWIYLSKKEHFFEAATVLYALANSDFDLTLNDRIECLAR   1128
WashU_Sklu_Contig2332.4   
   --------------------------------------------------   
WashU_Smik_Contig2834.3   1087   RAEKSLEISNLLWLYLSKEECFFEAAAVLYALASSDFDLKLSERIECLAR   1136
Symbols










SGD_Scer_NUP157/YER105C   1137   ANGLCDSSTSFDQKPALVQLSENIHELFDIASIQDDLLNLVRNETRIDED   1186
MIT_Smik_c620_6467   1137   ANGFCDSSTSFDQRPALVQLSDNIHELFDIAAIQDDLLNLVRRETRINEN   1186
MIT_Spar_c333_6591   1137   ANGFCDSSTSFDRKPALVQLSENIHELFDIAAIQDDLLSLVEGETRIDEH   1186
MIT_Suva_c371_6839   1129   ANGFCDSSSSFDQKPALVQLSDSIHELFDITAIQDDILTLVENETRINED   1178
WashU_Sbay_Contig677.56   1129   ANGFCDSSSSFDQKPALVQLSDSIHELFDITAIQDDILTLVENETRINED   1178
WashU_Sklu_Contig2332.4   
   --------------------------------------------------   
WashU_Smik_Contig2834.3   1137   ANGFCDSSTSFDQRPALVQLSDNIHELFDIAAIQDDLLNLVRRETRINEN   1186
Symbols










SGD_Scer_NUP157/YER105C   1187   YRKQLTLKLNGRVLPLSDLFNDCADPLDYYEIKLRIFKVSQFKDEKVIQG   1236
MIT_Smik_c620_6467   1187   YKKQLLLELNGKVLPLFYLFNDYADPLEYYEIKLKIFRASHFNDEKVIQE   1236
MIT_Spar_c333_6591   1187   YRKQLILKLNGKVLPLSDLFNDCADPLDYYEIKLRIFKVSQFKDEKVIQG   1236
MIT_Suva_c371_6839   1179   HKKELISKLNGKVLPLSYLFNDCADPLGYHEINLRIFKASGLRDESVIRR   1228
WashU_Sbay_Contig677.56   1179   HKKELISKLNGKVLPLSYLFNDCADPLGYHEINLRIFKASGLRDESVIRR   1228
WashU_Sklu_Contig2332.4   
   --------------------------------------------------   
WashU_Smik_Contig2834.3   1187   YKKQLLLELNGKVLPLFYLFNDYADPLEYYEIKLKIFRASHFNDEKVIQE   1236
Symbols










SGD_Scer_NUP157/YER105C   1237   EWNRLLDSMKNAPSPDVGSVGQESFLSSISNTLIRIGKTTRDTDVVFPVH   1286
MIT_Smik_c620_6467   1237   EWDRLIDSIKKTALFDGKDEGQAFFFSAISSTLIRIGKTTHDTDVIFPVH   1286
MIT_Spar_c333_6591   1237   EWDRLIDSIKNTPLPDGKSAGQESFLSSISNTLSRIGKITHDTDVIFPVQ   1286
MIT_Suva_c371_6839   1229   EWDRLFDVIKMKVLPDRKCGDPESIISTISSALIRVGKITHDTEIIFPVH   1278
WashU_Sbay_Contig677.56   1229   EWDRLFDVIKMKVLPDRKCGDPESIISTISSALIRVGKITHDTEIIFPVH   1278
WashU_Sklu_Contig2332.4   
   --------------------------------------------------   
WashU_Smik_Contig2834.3   1237   EWDRLIDSIKKTALFDGKDEGQAFFFSAISSTLIRIGKTTHDTDVIFPVH   1286
Symbols










SGD_Scer_NUP157/YER105C   1287   FLMNKILESFIDKSSAADG---SVCSMFLLAGVSHLKLYYILSRIIENSE   1333
MIT_Smik_c620_6467   1287   FLINKLFALFPATPSTADG---SISSIFLLAGISHLKLYYILKDIIKNSE   1333
MIT_Spar_c333_6591   1287   FLMNKILESFPNKSPAADG---SICSIFLLAGVSHLKLYYTLNHIIKNSE   1333
MIT_Suva_c371_6839   1279   FLMNKVLALFSDEASTINIQDRSVCSIFISAGVSYLKIYYTLKDIIRSSE   1328
WashU_Sbay_Contig677.56   1279   FLMNKVLALFSDEASTINIQDRSVCSIFISAGVSYLKIYYTLKDIIRSSE   1328
WashU_Sklu_Contig2332.4   
   --------------------------------------------------   
WashU_Smik_Contig2834.3   1287   FLINKLFALFPATPSTADG---SISSIFLLAGISHLKLYYILKDIIKNSE   1333
Symbols










SGD_Scer_NUP157/YER105C   1334   GNVELAKKEMVWLIKDWYQSDSDLRGSIAPEQIKKLEKYDPNTDPVQDYV   1383
MIT_Smik_c620_6467   1334   ENIEMARKEIVWLIKEWYQNDPELHNFIAPEQIKRLEKYDPDTDPIQSYV   1383
MIT_Spar_c333_6591   1334   GNVELARKEMVWLIKDWYQNNPELRGSITPEQIEKLEKYDPDTDLVQDYV   1383
MIT_Suva_c371_6839   1329   GSTELAKKEMVLLIKEWYQNDTELRGSIPLDQIKRLEKYDLDTDPVQNYV   1378
WashU_Sbay_Contig677.56   1329   GSTELAKKEMVLLIKEWYQNDTELRGSIPLDQIKRLEKYDLDTDPVQNYV   1378
WashU_Sklu_Contig2332.4   
   --------------------------------------------------   
WashU_Smik_Contig2834.3   1334   ENIEMARKEIVWLIKEWYQNDPELHNFIAPEQIKRLEKYDPDTDPIQSYV   1383
Symbols










SGD_Scer_NUP157/YER105C   1384   KDRHHGLK   1391
MIT_Smik_c620_6467   1384   NDRQS---   1388
MIT_Spar_c333_6591   1384   KDRHHGMK   1391
MIT_Suva_c371_6839   1379   KNSQHNKK   1386
WashU_Sbay_Contig677.56   1379   KNSQHNKK   1386
WashU_Sklu_Contig2332.4   
   --------   
WashU_Smik_Contig2834.3   1384   NDRQS---   1388
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_NUP157/YER105C:

SGD_Scer_NUP157/YER105C  Length: 1392  Mon Nov  7 15:16:05 2016  Type: P  Check: 2887  ..

       1  MYSTPLKKRI DYDRETFTAS ASLGGNRLRN RPRDDQNNGK PNLSSRSFLS

      51  ERKTRKDVLN KYGEAGNTIE SELRDVTTHV KISGLTSSEP LQLASEFVQD

     101  LSFRDRNTPI LDNPDYYSKG LDYNFSDEVG GLGAFTPFQR QQVTNIPDEV

     151  LSQVSNTEIK SDMGIFLELN YCWITSDNKL ILWNINNSSE YHCIDEIEHT

     201  ILKVKLVKPS PNTFVSSVEN LLIVATLFDI YILTISFNDR THELNIFNTG

     251  LKVNVTGFNV SNIISYERTG QIFFTGATDG VNVWELQYNC SENLFNSKSN

     301  KICLTKSNLA NLLPTKLIPS IPGGKLIQKV LEGDAGTEEE TISQLEVDQS

     351  RGVLHTLSTK SIVRSYLITS NGLVGPVLID AAHIRRGMNA LGVKNSPLLS

     401  NRAFKIAKIV SISMCENNDL FLAVITTTGV RLYFKGSISR RSIGSLKLDS

     451  VKFPPTSISS SLEQNKSFII GHHPLNTHDT GPLSTQKASS TYINTTCAST

     501  IISPGIYFTC VRKRANSGEL SKGITNKALL ENKEEHKLYV SAPDYGILKN

     551  YGKYVENTAL LDTTDEIKEI VPLTRSFNYT STPQGYANVF ASQYSAEPLK

     601  VAVLTSNALE IYCYRTPDEV FESLIENPLP FIHSYGLSEA CSTALYLACK

     651  FNKSEHIKSS ALAFFSAGIP GVVEIKPKSS RESGSVPPIS QNLFDKSGEC

     701  DGIVLSPRFY GSALLITRLF SQIWEERVFV FKRASKTEKM DAFGISITRP

     751  QVEYYLSSIS VLADFFNIHR PSFVSFVPPK GSNAITASDA ESIAMNALIL

     801  LINSIKDALS LINVFYEDID AFKSLLNTLM GAGGVYDSKT REYFFDLKFH

     851  DLFTPNAKTK QLIKEILIEV VNANIASGTS ADYIVNVLKE RFGSFCHSAD

     901  ILCYRAGEHL EAAQKFEMID SKISRNHLDT AIDLYERCAE NIELCELRRV

     951  VDIMVKLNYQ PKTVGFLLRF ADKIDKGNQA QEYVSRGCNT ADPRKVFYDK

    1001  RINVYTLIFE IVKSVDDYTS IEQSPSIANI SIFSPASSLK KRVYSVIMNS

    1051  NNRFFHYCFY DWLVANKRQD YLLRLDSQFV LPYLKERAEK SLEISNLLWF

    1101  YLFKEEHFLE AADVLYALAS SDFDLKLSER IECLARANGL CDSSTSFDQK

    1151  PALVQLSENI HELFDIASIQ DDLLNLVRNE TRIDEDYRKQ LTLKLNGRVL

    1201  PLSDLFNDCA DPLDYYEIKL RIFKVSQFKD EKVIQGEWNR LLDSMKNAPS

    1251  PDVGSVGQES FLSSISNTLI RIGKTTRDTD VVFPVHFLMN KILESFIDKS

    1301  SAADGSVCSM FLLAGVSHLK LYYILSRIIE NSEGNVELAK KEMVWLIKDW

    1351  YQSDSDLRGS IAPEQIKKLE KYDPNTDPVQ DYVKDRHHGL K*


Protein Sequence for MIT_Smik_c620_6467:

MIT_Smik_c620_6467  Length: 1389  Mon Nov  7 15:16:05 2016  Type: P  Check: 7893  ..

       1  MYSTPLKKRV DYDHETFTVA NSLGRNRSQN QLRDDPDQGK LNLSGSSFQT

      51  KKSTNNNIMN NCGEMGSTVE SELHDVNTHV KVSGLASSEP LQLASEFVQD

     101  LNFRDKNTPV LDNADYCRKG VDYNFSDEVG GLGAFTPFQR RQVINIPDEV

     151  LLEVSSTEIK SDMGIFPELN FCWITSDNKL ILWNINNSSE FHCIDEIEHT

     201  ILKVKLVKPR QKTFVSSVEN LLIVATLFDI YILTISFDDL THELNISNTG

     251  LKVNATGLNV SNIINYEKTG QIFFTGSTDG VNVWELQYNC SENLFNSKCD

     301  KICLTKSSLA NLLPTRLIPN VPGGKLIQRV LEGDDEVGEE TILQLDLDQS

     351  RGILHTLSTK SIIRSYLITN NGLESPAMID APHIRRSISA FGLKDSPLLT

     401  NRAFKIAKIV SISKWESNDL FLAVITTSGV RLYLKGITSK RSIGSLKLDF

     451  LKLPPTCLFN SFVKNDFSTV NHSHLYSKDK SLISAQKASS VYINTSYAST

     501  IISPGIYFTS VTKPSNFGEL SNDNARKDGQ EKREEHKLYV SAPDYGLLKN

     551  YGKYVENTVL LDTTDEIKEI VPLTRCFNYT STPQGYANVF ASQYNVEPLK

     601  VAVLTSNALE IYCYRTPDEV FESLIENPLP FIHKYGLSEA CSTALYLACK

     651  FNKSEYVKAG ALAFFSAGIP GVVEIKPKDS RDSGCLLQIA QKKLAKFSES

     701  DDIVLSPRFY GSALLITRLF SQIWEDKIFI FRKVSRADKS NMFGISITRP

     751  QVEYYLSSIS VLADFFKNHH SSFVSFVDPK NSDAITASDA ESIAMNSLIL

     801  LINSIKDALS LLNVFYEDID TFKSLLNTLM GEGGIYDSKT REYFLNLEFH

     851  DLFTPNIETK QVIKEILIEI VNANIANGAP ADYIMNVFKE RFGSFCHGAD

     901  ILCYRAGEHL EAAQKFEIID SKISRNHLDT AIDFYERCAE NIKLDELRNI

     951  VNMMVKLDYQ PRTVEFLLKV ADKIDKANQA QEYVSGGCKI DDPRRVFYNK

    1001  RVDVYKIIFD ILKSVDDNTS IEQSVPAKNI AISSPALSLK ESIYSVIINS

    1051  NNRLFHYCFY DWLVANKRQD GLLQLDSQFV LPYLKERAEK SLEISNLLWL

    1101  YLSKEECFFE AAAVLYALAS SDFDLKLSER IECLARANGF CDSSTSFDQR

    1151  PALVQLSDNI HELFDIAAIQ DDLLNLVRRE TRINENYKKQ LLLELNGKVL

    1201  PLFYLFNDYA DPLEYYEIKL KIFRASHFND EKVIQEEWDR LIDSIKKTAL

    1251  FDGKDEGQAF FFSAISSTLI RIGKTTHDTD VIFPVHFLIN KLFALFPATP

    1301  STADGSISSI FLLAGISHLK LYYILKDIIK NSEENIEMAR KEIVWLIKEW

    1351  YQNDPELHNF IAPEQIKRLE KYDPDTDPIQ SYVNDRQS*

Protein Sequence for MIT_Spar_c333_6591:

MIT_Spar_c333_6591  Length: 1392  Mon Nov  7 15:16:05 2016  Type: P  Check: 8698  ..

       1  MYSTPLKKRV DYDRETFTVP ASLGRDRLQN QLRDDQNKGK LNLSSISFPS

      51  KKPTRKDVLD KYSEAGNTIE PEFHDVTTHV KVSGLTSSEP LQLASEFVQD

     101  LNFRDRNTPI LDNSAYYRKG VDYNFSDEVG GLGAFTPFQR QQVTNIPDEV

     151  LLEVSNTEIK SDMGMFLELN YCWITSDNKL ILWNINNSSE FHCIDEIEHT

     201  ILKVKLVKPR PNTFVSSVEN LLIVATLFDI YILTISFDDH THELNIFNTG

     251  LKVNVTGFNV SNIISYERTG QVFFTGSTDS VNVWELQYNC SENLFNSKCN

     301  KICLTKSSFA NLLPTKLIPS MPGGKLIQKV LEGDSGAEEE TISQLDIDQS

     351  RGVLHTLSTK SIVRSYLITS NGLEGPVLID IPHIRRSISA LGIKDSPLLS

     401  SRAFKIARIV SISKRENNDL FLAVITTTGV RLYFKGFTSR RSIGSLKLDF

     451  LKFPPTSISN SLEKKKFSIV NQKHLYTQDI CPLSAQKASS TYINTTCAST

     501  IISPGIYFTS VKKRNNSGES SNSIARRNQL ENKEEHKLYV SVPDYGILKN

     551  YGKYVENTTL LDTTDEVKEI VPLTRCFNYT STPQGYANFF ASQYNVEPLK

     601  VAVLTSNALE IYCYRTPDEV FESLIENPLP FIRSYGLSEA CSTALYLACK

     651  FNKSEHIKAS ALAFFSAGIP GIVEIKPKNS RDSSSVPPIA QKILDKSGEG

     701  DNIVLSPRFY GSALLITRLF CQIWEEKVFV FRRASKAEKS NIFGISITRP

     751  QVEYYLSSIS VLADFFNIHR PSFVSFVSPK DSNTITASDA ESIAMNALIL

     801  LINSIKDALS LLNVFYEDID AFKSLLNTLM GEGGVYDSKT REYFFSLHFH

     851  DLFTPNTETK QLIKEILIEV VNANIASGAP ADYIMNVLKE RFGSFCHGAD

     901  ILCYRAGEHL EAAQKFEIID SKISRNHLDT AIDLYERCAD NIELNELRRI

     951  VDIMVKLNYQ PRTVEFLLRV ADKIDKANQA QEYVSEGSKI ADPRKDFYDK

    1001  RINVYTLIFD IVKSVDDNTP AEQSPSIANI SISSPALSLK ERVYSVMMNS

    1051  SNRFFHYCFY DWLVANKRQD DLLQLHSQFV LPYLKEKAEK SLEICNLLWF

    1101  YLSKEEHFLE AADVLYALAS ADFDLKLSER IECLARANGF CDSSTSFDRK

    1151  PALVQLSENI HELFDIAAIQ DDLLSLVEGE TRIDEHYRKQ LILKLNGKVL

    1201  PLSDLFNDCA DPLDYYEIKL RIFKVSQFKD EKVIQGEWDR LIDSIKNTPL

    1251  PDGKSAGQES FLSSISNTLS RIGKITHDTD VIFPVQFLMN KILESFPNKS

    1301  PAADGSICSI FLLAGVSHLK LYYTLNHIIK NSEGNVELAR KEMVWLIKDW

    1351  YQNNPELRGS ITPEQIEKLE KYDPDTDLVQ DYVKDRHHGM K*


Protein Sequence for MIT_Suva_c371_6839:

MIT_Suva_c371_6839  Length: 1387  Mon Nov  7 15:16:05 2016  Type: P  Check: 712  ..

       1  MYSTPLKKRV DYDREAFKFP GTSGQNHLPD RLRDGQGQHN PNLSNSPLQT

      51  SRLDNNIQQK YGEAANTVDI NTHVEVSGFT SSDPLQLASG FVQDLSLGDR

     101  STPVLDSPSY YRSGVNYNFT NEVGGLGAFT PFQRQQVTNI PDEVVSEVSS

     151  TEIKSDMGIF PELGYCWITS DNKLILWNIN NSSEFHCIDE IEHTILKVKL

     201  VKPRSNTFVS SVENLLIVAT LFDIYILTIS FDSTTHKLNI FNTGLKVNAT

     251  GLNVSNITNY EKTGQIFFTG SSDGVNVWEL QYNCSENLFN SKCSKVCLTK

     301  SNLANLLPTR LISGVPGSKM IQRVLEGDVN VGEETILQLI VDQSRGVLHT

     351  LSTKSIVRSY LITSDGLEGP VLIDAPHIRR SLGALDAKDS PLLTSRLLKI

     401  VKIIPISKWE NNDIFLALIT TAGVRLYFKG STSKRSIGSL KLVSLKCPPA

     451  NSSDKFQKNG FSAVNQKPLY TKSPSPLSAQ KKSSVYIDTT DASTIISPGI

     501  YFTSVRGTNN SEDLSNNFSH IHMLEKKEEC KLYVSVPDYG ILKNHGKYVE

     551  NTALLDTTDE IKEIVSLTKF FNYTSTPQGY ANAFASQYNA EPLKIAVLTS

     601  NAVEIYGYRR PDEIFESLIE NPLPFIHNYG LSEACSTALY LTCRFNKSEH

     651  VKASALGFLL AGIPGVVEIK PQYLRDSGSL SSITPETPNK FDDGNGIALS

     701  PRFYGSALLV TRLLSQIWEE KVFTSKMIPK TTNMFGISIT RLQVEYYLSS

     751  ISVLADFFNI HRSSFVSFLT PSDANVLTAS DAESIAMEAL ILLVNSIKDA

     801  LSLLNVFYEE IDAFKSLLYT LMGERGIYDS KTRDYFFNLR FHDLFTPNTE

     851  TKQIVKEILI EIVNANITRG ASADYIMNVL KERCGSFCSG TDILCFRAGE

     901  HLEAAQKFEM VDSKLSRNHL DSAVDLYERC AESMEINELK RIVDVMVKLN

     951  YQPRTVEFLL RVADGIDKEN QAQGYAAEGC RINDPRKKFY EKRISVYNLI

    1001  FDILKTVDEN TSVEQSSSVG KITISSPAMS LKERVYSMIL NSNNRFFHYC

    1051  FYDWLVQNGR EDDLLQLDSQ FVLSYLKEKA EKSLEASNLL WIYLSKKEHF

    1101  FEAATVLYAL ANSDFDLTLN DRIECLARAN GFCDSSSSFD QKPALVQLSD

    1151  SIHELFDITA IQDDILTLVE NETRINEDHK KELISKLNGK VLPLSYLFND

    1201  CADPLGYHEI NLRIFKASGL RDESVIRREW DRLFDVIKMK VLPDRKCGDP

    1251  ESIISTISSA LIRVGKITHD TEIIFPVHFL MNKVLALFSD EASTINIQDR

    1301  SVCSIFISAG VSYLKIYYTL KDIIRSSEGS TELAKKEMVL LIKEWYQNDT

    1351  ELRGSIPLDQ IKRLEKYDLD TDPVQNYVKN SQHNKK*

Protein Sequence for WashU_Sbay_Contig677.56:

WashU_Sbay_Contig677.56  Length: 1387  Mon Nov  7 15:16:05 2016  Type: P  Check: 712  ..

       1  MYSTPLKKRV DYDREAFKFP GTSGQNHLPD RLRDGQGQHN PNLSNSPLQT

      51  SRLDNNIQQK YGEAANTVDI NTHVEVSGFT SSDPLQLASG FVQDLSLGDR

     101  STPVLDSPSY YRSGVNYNFT NEVGGLGAFT PFQRQQVTNI PDEVVSEVSS

     151  TEIKSDMGIF PELGYCWITS DNKLILWNIN NSSEFHCIDE IEHTILKVKL

     201  VKPRSNTFVS SVENLLIVAT LFDIYILTIS FDSTTHKLNI FNTGLKVNAT

     251  GLNVSNITNY EKTGQIFFTG SSDGVNVWEL QYNCSENLFN SKCSKVCLTK

     301  SNLANLLPTR LISGVPGSKM IQRVLEGDVN VGEETILQLI VDQSRGVLHT

     351  LSTKSIVRSY LITSDGLEGP VLIDAPHIRR SLGALDAKDS PLLTSRLLKI

     401  VKIIPISKWE NNDIFLALIT TAGVRLYFKG STSKRSIGSL KLVSLKCPPA

     451  NSSDKFQKNG FSAVNQKPLY TKSPSPLSAQ KKSSVYIDTT DASTIISPGI

     501  YFTSVRGTNN SEDLSNNFSH IHMLEKKEEC KLYVSVPDYG ILKNHGKYVE

     551  NTALLDTTDE IKEIVSLTKF FNYTSTPQGY ANAFASQYNA EPLKIAVLTS

     601  NAVEIYGYRR PDEIFESLIE NPLPFIHNYG LSEACSTALY LTCRFNKSEH

     651  VKASALGFLL AGIPGVVEIK PQYLRDSGSL SSITPETPNK FDDGNGIALS

     701  PRFYGSALLV TRLLSQIWEE KVFTSKMIPK TTNMFGISIT RLQVEYYLSS

     751  ISVLADFFNI HRSSFVSFLT PSDANVLTAS DAESIAMEAL ILLVNSIKDA

     801  LSLLNVFYEE IDAFKSLLYT LMGERGIYDS KTRDYFFNLR FHDLFTPNTE

     851  TKQIVKEILI EIVNANITRG ASADYIMNVL KERCGSFCSG TDILCFRAGE

     901  HLEAAQKFEM VDSKLSRNHL DSAVDLYERC AESMEINELK RIVDVMVKLN

     951  YQPRTVEFLL RVADGIDKEN QAQGYAAEGC RINDPRKKFY EKRISVYNLI

    1001  FDILKTVDEN TSVEQSSSVG KITISSPAMS LKERVYSMIL NSNNRFFHYC

    1051  FYDWLVQNGR EDDLLQLDSQ FVLSYLKEKA EKSLEASNLL WIYLSKKEHF

    1101  FEAATVLYAL ANSDFDLTLN DRIECLARAN GFCDSSSSFD QKPALVQLSD

    1151  SIHELFDITA IQDDILTLVE NETRINEDHK KELISKLNGK VLPLSYLFND

    1201  CADPLGYHEI NLRIFKASGL RDESVIRREW DRLFDVIKMK VLPDRKCGDP

    1251  ESIISTISSA LIRVGKITHD TEIIFPVHFL MNKVLALFSD EASTINIQDR

    1301  SVCSIFISAG VSYLKIYYTL KDIIRSSEGS TELAKKEMVL LIKEWYQNDT

    1351  ELRGSIPLDQ IKRLEKYDLD TDPVQNYVKN SQHNKK*

Protein Sequence for WashU_Sklu_Contig2332.4:

WashU_Sklu_Contig2332.4  Length: 1037  Mon Nov  7 15:16:05 2016  Type: P  Check: 6163  ..

       1  MSIFSTPLKS GIDYNSSLVA TANRNTDINP ISVPTQTTAT TVLTGSYNAL

      51  AANTLPSHGN EHIHVNGLGT LRPLELASQY VDSLQRRDSS TPILDERSYY

     101  NGGVTYNFSK EVGGLGAFTP FERTQVINIP DEILQEASKT EIKSDMGIFP

     151  ELERCWITID NKLILWNIKD TSDFQAIDDI KHTILKVALV KPKPKTFVDN

     201  INHLLLIATP FDIYLLAISF NETTGELEVF NTGICVSVHG LDVSEIIFYE

     251  KTGQVFFAGK SNGINVWELQ YSSSEDWFNS KCNKVCLTQS TLSSLLPTNI

     301  ISKLPGSNLL QSFFEEDSQY SQETIIQLSV DQSRGVLYSL SSKSVVRAYK

     351  INGKSLDGPM TIEPSYIRRI IGTTTARGAA ILGNKYLKIS KIVVVSEHEN

     401  NNLFLVAITI GGVRLYFNGS LNRTNVEALR LESIKFPPSS ITPDAIEQEF

     451  QQQQQKKLMP FYSSLNSSES IQLKYQKKSS VLLESTKAST IISPGIFFSA

     501  VVKTNLQDPS KQPTNQQKQQ QQQQQQQNRL FVTVPDYGIL KNHGKYVENA

     551  CFLDTTSSIK EIVSITPSFN ATNKPEGYAN EFATQYSTES FKVAVLTNNS

     601  VEIYRYRTPD QVFESVIENP LPFVMNYGLA EACSSALFVT CKFNKSESLR

     651  SSALTFFTVG IPGVVEIKPR YNSYSTSAVS SLLSKTNITM TPQKSLLNVS

     701  TGDVSRIPTS AGSTVVNGNY NLDNVILSPR FYGIALLITR LFRDIWDKPV

     751  FSVNSNAKYD TKLQLIKESV PNGDLIKLVS ISKSDVEYYL SSIMILNEFF

     801  NSYGNSISTI STPSFQNNGG RSTDRSEEVS NQAESIAINA LIKLVQSMKE

     851  ALSFLNVLFE ESDVDGYEGQ YLAFKDIMKF LNLDIQIDLT KLRFKDIFAP

     901  DEQAKNLVRE ILSSIINRNI SKGGSIEYIA TALQERCGSF CSSGDVLGFR

     951  AVEHLRKAKE IGLRDYETLN YHLTNATKLF EKIVNDISVD KLKEAVTIML

    1001  DLNYYPKTIE FLLNIANSID KGKLAYQYVA CRMFRAX

Protein Sequence for WashU_Smik_Contig2834.3:

WashU_Smik_Contig2834.3  Length: 1389  Mon Nov  7 15:16:05 2016  Type: P  Check: 8976  ..

       1  MYSTPLKKRV DYDHETFTVA NSLGRNRSQN QLRDDPDQGK LNLSGSSFQT

      51  KKSTNNNIMN NCGEMGSTVE SELHDVNTHV KVSGLASSEP LQLASEFVQD

     101  LNFRDKNTPV LDNADYCRKG VDYNFSDEVG GLGAFTPFQR RQVINIPDEV

     151  LLEVSSTEIK SDMGIFPELN FCWITSDNKL ILWNINNSSE FHCIDEIEHT

     201  ILKVKLVKPR QKTFVSSVEN LLIVATLFDI YILKISFDDL THELNISNTG

     251  LKVNATGLNV SNIINYEKTG QIFFTGSTDG VNVWELQYNC SENLFNSKCN

     301  KICLTKSSLA NLLPTRLIPN VPGGKLIQRV LEGDDEVGEE TILQLDLDQS

     351  RGILHTLSTK SIIRSYLITN NGLESPAMID APHIRRSISA FGLKDSPLLT

     401  NRAFKIAKIV SISKWESNDM FLAVITTSGV RLYLKGITSK RSIGSLKLDF

     451  LKLPPTCLFN SFVKNDFSTV NHSHLYSKDK SLISAQKASS VYINTSYAST

     501  IISPGIYFTS VTKPSNFGEL SNDNARKDGQ EKREEHKLYV SAPDYGLLKN

     551  YGKYVENTVL LDTTDEIKEI VPLTRCFNYT STPQGYANVF ASQYNVEPLK

     601  VAVLTSNALE IYCYRTPDEV FESLIENPLP FIHKYGLSEA CSTALYLACK

     651  FNKSEYVKAG ALAFFSAGIP GVVEIKPKDS RDSGCLLQIA QKKLAKFSES

     701  DDIVLSPRFY GSALLITRLF SQIWEDKIFI FRKVSRADKS NMFGISITRP

     751  QVEYYLSSIS VLADFFKNHH SSFVSFVDPK NSDAITVSDA ESIAMNSLIL

     801  LINSIKDALS LLNVFYEDID TFKSLLNTLM GEGGIYDSKT REYFLNLEFH

     851  DLFTPNIETK QVIKEILIEI VNANIANGAP ADYIMNVFKE RFGSFCHGAD

     901  ILCYRAGEHL EAAQKFEIID SKISRNHLDT AIDFYERCAE NIKLDELRNI

     951  VNMMVKLDYQ PRTVEFLLKV ADKIDKANQA QEYVSGGCKI DDPRRVFYNK

    1001  RVDVYKIIFD ILKSVDDNTS IEQSVPAKNI AISSPALSLK ESIYSVIINS

    1051  NNRLFHYCFY DWLVANKRQD GLLQLDSQFV LPYLKERAEK SLEISNLLWL

    1101  YLSKEECFFE AAAVLYALAS SDFDLKLSER IECLARANGF CDSSTSFDQR

    1151  PALVQLSDNI HELFDIAAIQ DDLLNLVRRE TRINENYKKQ LLLELNGKVL

    1201  PLFYLFNDYA DPLEYYEIKL KIFRASHFND EKVIQEEWDR LIDSIKKTAL

    1251  FDGKDEGQAF FFSAISSTLI RIGKTTHDTD VIFPVHFLIN KLFALFPATP

    1301  STADGSISSI FLLAGISHLK LYYILKDIIK NSEENIEMAR KEIVWLIKEW

    1351  YQNDPELHNF IAPEQIKRLE KYDPDTDPIQ SYVNDRQS*