Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YER073W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_ALD5/YER073W   1   MLSRTRAAAPNSRIFTRSLLRLYSQAPLRVPITLPNGFTYEQPTGLFING   50
MIT_Smik_c616_6610   1   MFSRTRATTLNSNSFARNLLRLYSQVPLRVPITLPNGFTYEQPTGLFING   50
MIT_Spar_c421_6331   1   MLSRTRATALNSNLFSRNLLRLYSQAPLRVPITLPNGHTYEQPTGLFING   50
MIT_Suva_c371_6986   1   MFSRTRTTALKSNSFARNLLRLYSQAPLHVPITLPNGLTYEQPTGLFING   50
WashU_Sbay_Contig677.89   1   MFSRTRTTALKSNSFARNLLRLYSQAPLHVPITLPNGLTYEQPTGLFING   50
WashU_Scas_Contig701.14   1   ----MFSRTITPRVISRRVIRLYSQLPLRVPVTLPNGLKYEQPTGLFING   46
WashU_Sklu_Contig2369.5   1   ------MLARSQITTLRRFVRLYSNLPLRVPVTLPNGITYEQPTGLFING   44
WashU_Skud_Contig1843.6   1   MFSRTRSVALNSNSFTRNLLRLYSQAPLRVPITLPNGFTYEQPTGLFING   50
WashU_Smik_Contig2898.7   1   MFSRTRATTLNSNSFARNLLRLYSQVPLRVPITLPNGFTYEQPTGLFING   50
Symbols






: . * .:****: **:**:***** .***********



SGD_Scer_ALD5/YER073W   51   EFVASKQKKTFDVINPSNEEKITTVYKAMEDDVDEAVAAAKKAFETKWSI   100
MIT_Smik_c616_6610   51   EFVASKQKKTFDVINPSNEEKITTVYKAMEDDVDTAVAAAKKAFETKWSI   100
MIT_Spar_c421_6331   51   EFVASKQRKTFDVINPSNEEKITTVYKAMEDDVDTAVAAAKKAFDTKWSI   100
MIT_Suva_c371_6986   51   EFVASKQKKTFDVINPSTEEKITTVYKAMEDDVDTAVAAAKKAFETKWSI   100
WashU_Sbay_Contig677.89   51   EFVASKQKKTFDVINPSTEEKITTVYKAMEDDVDTAVAAAKKAFETKWSI   100
WashU_Scas_Contig701.14   47   DFVPSKQNKIFEVINPSTEEVITPVYEAMEDDVDIAVAAAKKAFKS-WSI   95
WashU_Sklu_Contig2369.5   45   EFVPSRQHKTFEVINPSNEEEVTHVYEAREDDVDIAVAAAKKAFDNGWST   94
WashU_Skud_Contig1843.6   51   EFVASKQQKTFDVINPSTEEKITTVYKAMEDDVDVAVAAAKKAFETKWSI   100
WashU_Smik_Contig2898.7   51   EFVASKQKKTFDVINPSNEEKITTVYKAMEDDVDTAVAAAKKAFETKWSI   100
Symbols






:**.*:*.* *:*****.** :* **:* ***** *********.. **



SGD_Scer_ALD5/YER073W   101   VEPEVRAKALFNLADLVEKHQETLAAIESMDNGKSLFCARGDVALVSKYL   150
MIT_Smik_c616_6610   101   VEPEVRAKALFKLADLVEENKETLAAIESMDNGKSLFCARGDVALVSKYL   150
MIT_Spar_c421_6331   101   VEPEVRAKALFNLADLVEKNQETLAAIESMDNGKSLFCARGDVALVSKYL   150
MIT_Suva_c371_6986   101   VEPEVRARALFNLADLVEKNQETLAAIESMDNGKSLFCSRGDVALVSKYL   150
WashU_Sbay_Contig677.89   101   VEPEVRARALFNLADLVEKNQETLAAIESMDNGKSLFCSRGDVALVSKYL   150
WashU_Scas_Contig701.14   96   ADPEVRASALFKLANLVEKNAELLASIETADNGKSLLCSRGDVALVSKYL   145
WashU_Sklu_Contig2369.5   95   AEPEFRAQCLYKLADLIEKNAETLAGIESLDNGKSLFCSRGDVALVSKYL   144
WashU_Skud_Contig1843.6   101   VEPEVRAKALFNLADLVEKNQETLAAIESMDNGKSLFCARGDVALVSKYL   150
WashU_Smik_Contig2898.7   101   VEPEVRAKALFKLADLVEENKETLAAIESMDNGKSLFCARGDVALVSKYL   150
Symbols






.:**.** .*::**:*:*:: * **.**: ******:*:***********



SGD_Scer_ALD5/YER073W   151   RSCGGWADKIYGNVIDTGKNHFTYSIKEPLGVCGQIIPWNFPLLMWSWKI   200
MIT_Smik_c616_6610   151   RSCGGWADKIYGNVIDTGRDHFTYSMKEPLGVCGQIIPWNFPLLMWSWKI   200
MIT_Spar_c421_6331   151   RSCGGWADKIYGNVIDTGRDHFTYSIKEPLGVCGQIIPWNFPLLMWSWKI   200
MIT_Suva_c371_6986   151   RSCGGWADKLNGNVIDTGKDHFTYSVKEPLGVCGQIIPWNFPLLMWSWKI   200
WashU_Sbay_Contig677.89   151   RSCGGWADKLNGNVIDTGKDHFTYSVKEPLGVCGQIIPWNFPLLMWSWKI   200
WashU_Scas_Contig701.14   146   RSCGGWADKINGNVINTGDNHFAYTTREPLGVCGQIIPWNFPLLMWSWKI   195
WashU_Sklu_Contig2369.5   145   RSCAGWSDKLFGKVIDTGSDHFAYTKREPLGVCGQIIPWNFPLLMWSWKI   194
WashU_Skud_Contig1843.6   151   RSCGGWADKIYGNVIDTGKDHFTYSVREPLGVCGQIIPWNFPLLMWSWKI   200
WashU_Smik_Contig2898.7   151   RSCGGWADKIYGNVIDTGRDHFTYSMKEPLGVCGQIIPWNFPLLMWSWKI   200
Symbols






***.**:**: *:**:** :**:*: :***********************



SGD_Scer_ALD5/YER073W   201   GPALATGNTVVLKPAETTPLSALFASQLCQEAGIPAGVVNILPGSGRVVG   250
MIT_Smik_c616_6610   201   GPALATGNTVVLKPAETTPLSALFASQLCQEAGIPAGVVNILPGSGRVVG   250
MIT_Spar_c421_6331   201   GPALATGNTVVLKPAETTPLSALFASQLCQEAGIPAGVVNILPGSGRVVG   250
MIT_Suva_c371_6986   201   GPALATGNTVVLKPAETTPLSALFASQLCQEAGIPAGVVNILPGSGRVVG   250
WashU_Sbay_Contig677.89   201   GPALATGNTVVLKPAETTPLSALFASQLCQEAGIPAGVVNILPGSGRVVG   250
WashU_Scas_Contig701.14   196   GPALATGNTVVLKPAETTPLSALFASQLCIEAGIPKGVVNIIPGSGRVVG   245
WashU_Sklu_Contig2369.5   195   GPALATGNTVVLKPAEATPLSALYASQLCQEAGIPKGVVNIIPGFGKIVG   244
WashU_Skud_Contig1843.6   201   GPALATGNTVVLKPAETTPLSALFASQLCQEAGIPAGVVNILPGSGRVVG   250
WashU_Smik_Contig2898.7   201   GPALATGNTVVLKPAETTPLSALFASQLCQEAGIPAGVVNILPGSGRVVG   250
Symbols






****************:******:***** ***** *****:** *::**



SGD_Scer_ALD5/YER073W   251   ERLSAHPDVKKIAFTGSTATGRHIMKVAADTVKKVTLELGGKSPNIVFAD   300
MIT_Smik_c616_6610   251   EKLSAHPDVKKIAFTGSTATGRHIMKVAADTVKKVTLELGGKSPNIVFAD   300
MIT_Spar_c421_6331   251   ERLSVHPDVKKIAFTGSTATGRHIMKVAADTVKKVTLELGGKSPNIVFAD   300
MIT_Suva_c371_6986   251   ERLSAHPDVKKIAFTGSTATGRHIMKVAADTVKKVTLELGGKSPNIVFAD   300
WashU_Sbay_Contig677.89   251   ERLSAHPDVKKIAFTGSTATGRHIMKVAADTVKKVTLELGGKSPNIVFAD   300
WashU_Scas_Contig701.14   246   EKLCKHPDVKKIAFTGSTKTGSHIMKTAADTVKKVTLELGGKSPNIVFAD   295
WashU_Sklu_Contig2369.5   245   ERLCTHPEVKKVAFTGSTATGRHIMKTAADSIKKVTLELGGKSPNIVFGD   294
WashU_Skud_Contig1843.6   251   EKLSAHPDVKKIAFTGSTATGRHIMKVAADTVKKVTLELGGKSPNIVFAD   300
WashU_Smik_Contig2898.7   251   EKLSAHPDVKKIAFTGSTATGRHIMKVAADTVKKVTLELGGKSPNIVFAD   300
Symbols






*:*. **:***:****** ** ****.***::****************.*



SGD_Scer_ALD5/YER073W   301   ADLDKAVKNIAFGIFYNSGEVCCAGSRIYIQDTVYEEVLQKLKDYTESLK   350
MIT_Smik_c616_6610   301   ADINKAVENIAFGIFYNSGEVCCAGSRIYIQDTVYEEVLEKLKDYTESLK   350
MIT_Spar_c421_6331   301   ADLDKAVQNIAFGIFYNSGEVCCAGSRIYIQDTVYEEVLQKLKEYTESLK   350
MIT_Suva_c371_6986   301   ADLDKAVKNIAFGIFFNSGEVCCAGSRIYIQDTVYEEVLKKLKEYTETLK   350
WashU_Sbay_Contig677.89   301   ADLDKAVKNIAFGIFFNSGEVCCAGSRIYIQDTVYEEVLKKLKEYTETLK   350
WashU_Scas_Contig701.14   296   ADLDKAIENIAFGIFYNSGEVCCAGSRIYVQDTVYDTVLNKFKKYTENLK   345
WashU_Sklu_Contig2369.5   295   ADLDKAVKNIAFGIFFNSGEVCCAGSRVYVQDTVYEEVLQKFKEYTESLK   344
WashU_Skud_Contig1843.6   301   ADLDKAVKNIAFGIFFNSGEVCCAGSRIYIQDTVYEDVLQKLKSYTESLK   350
WashU_Smik_Contig2898.7   301   ADINKAVENIAFGIFYNSGEVCCAGSRIYIQDTVYEEVLEKLKDYTESLK   350
Symbols






**::**::*******:***********:*:*****: **:*:*.***.**



SGD_Scer_ALD5/YER073W   351   VGDPFDEEVFQGAQTSDKQLHKILDYVDVAKSEGARLVTGGARHGSKGYF   400
MIT_Smik_c616_6610   351   VGDPFNEEVFQGAQTSEKQLHKILEYVDVAKSEGARLVTGGVRHGNKGFF   400
MIT_Spar_c421_6331   351   VGDPFNEEVFQGAQTSDKQLHKILKYVDVAKSEGARLVTGGVRHGSKGYF   400
MIT_Suva_c371_6986   351   VGDPFNEEVFQGAQTSDKQLHKILDYVKVAKSEGARLVTGGERQGDKGYF   400
WashU_Sbay_Contig677.89   351   VGDPFNEEVFQGAQTSDKQLHKILDYVKVAKSEGARLVTGGERQGDKGYF   400
WashU_Scas_Contig701.14   346   VGDPFDESTFQGAQTSKAQLTKILKYVKVGTDEGARVVTGGERFGNKGYF   395
WashU_Sklu_Contig2369.5   345   VGNPFEDGVFQGAQTSKMQIDKILSYVDIGTKEGARIITGGEKKGEKGYF   394
WashU_Skud_Contig1843.6   351   VGDPFNEDNFQGAQTSDKQLHKILDYVAVAKSEGARLVTGGVRHGNKGYF   400
WashU_Smik_Contig2898.7   351   VGDPFNEEVFQGAQTSEKQLHKILEYVDVAKSEGARLVTGGVRHGNKGFF   400
Symbols






**:**:: *******. *: ***.** :...****::*** : *.**:*



SGD_Scer_ALD5/YER073W   401   VKPTVFADVKEDMRIVKEEVFGPIVTVSKFSTVDEVIAMANDSQYGLAAG   450
MIT_Smik_c616_6610   401   VKPTVFADVKEDMRIVKEEVFGPIVTVSKFSTVDDVIAMANDSQYGLAAG   450
MIT_Spar_c421_6331   401   VKPTVFADVKEDMRIVKEEVFGPIVTVSKFSTADEVIAMANNSEYGLAAG   450
MIT_Suva_c371_6986   401   IKPTIFADVKEDMRIVKEEVFGPIVTVSKFSTVDEVIAMANDSQYGLAAG   450
WashU_Sbay_Contig677.89   401   IKPTIFADVKEDMRIVKEEVFGPIVTVSKFSTVDEVIAMANDSQYGLAAG   450
WashU_Scas_Contig701.14   396   VKPTIFADVKEDMQIVKEEVFGPLVTISKFSTVDEVIDMANDSQYGLAAG   445
WashU_Sklu_Contig2369.5   395   IKPTIFADVKEDMRIVKEEIFGPIVSVSKFSSVDEVIAMANDSEYGLAAG   444
WashU_Skud_Contig1843.6   401   VKPTVFADVKEDMRIVKEEVFGPIVTVSKFSTVDEVIAMANNSQYGLAAG   450
WashU_Smik_Contig2898.7   401   VKPTVFADVKEDMRIVKEEVFGPIVTVSKFSTVDDVIAMANDSQYGLAAG   450
Symbols






:***:********:*****:***:*::****:.*:** ***:*:******



SGD_Scer_ALD5/YER073W   451   IHTNDINKAVDVSKRVKAGTVWINTYNNFHQNVPFGGFGQSGIGREMGEA   500
MIT_Smik_c616_6610   451   IHTNDINKAIDVSKRVKAGTVWVNTYNNFHQNVPFGGFGQSGIGREMGEA   500
MIT_Spar_c421_6331   451   IHTNDINKAVDVSKRVKAGTVWINTYNNFHQNVPFGGFGQSGIGREMGEA   500
MIT_Suva_c371_6986   451   IHTNDINKAINVSNRVKAGTVWVNTYNNFHQNVPFGGFGQSGIGREMGDA   500
WashU_Sbay_Contig677.89   451   IHTNDINKAINVSNRVKAGTVWVNTYNNFHQNVPFGGFGQSGIGREMGDA   500
WashU_Scas_Contig701.14   446   IHTKDVNKAIHVSKRIQAGTVWINTYNAFHQNVPFGGFGQSGIGREMGAA   495
WashU_Sklu_Contig2369.5   445   IHTKDVNKAIDVSNRIKAGTIWINTYNAFHQSVPFGGFGQSGIGREMGAE   494
WashU_Skud_Contig1843.6   451   IHTNDINKAIDVSNRVKAGTVWVNTYNNFHQSVPFGGFGQSGIGREMGEA   500
WashU_Smik_Contig2898.7   451   IHTNDINKAIDVSKRVKAGTVWVNTYNNFHQNVPFGGFGQSGIGREMGEA   500
Symbols






***:*:***:.**:*::***:*:**** ***.****************



SGD_Scer_ALD5/YER073W   501   ALSNYTQTKSVRIAIDKPIR   520
MIT_Smik_c616_6610   501   ALSNYTQTKSVRIAIDRPVR   520
MIT_Spar_c421_6331   501   ALSNYTQTKSVRIAIDKPIR   520
MIT_Suva_c371_6986   501   ALSNYTQVKSVRMAIDKPIR   520
WashU_Sbay_Contig677.89   501   ALSNYTQVKSVRMAIDKPIR   520
WashU_Scas_Contig701.14   496   ALDNYTQVKSVRMAIEKPEY   515
WashU_Sklu_Contig2369.5   495   ALDNYTQVKAVRMAIDKAQY   514
WashU_Skud_Contig1843.6   501   ALSNYTQTKSVRIAIDKPIR   520
WashU_Smik_Contig2898.7   501   ALSNYTQTKSVRIAIDRPVR   520
Symbols






**.****.*:**:**::.



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_ALD5/YER073W:

SGD_Scer_ALD5/YER073W  Length: 521  Mon Nov  7 15:15:12 2016  Type: P  Check: 3729  ..

       1  MLSRTRAAAP NSRIFTRSLL RLYSQAPLRV PITLPNGFTY EQPTGLFING

      51  EFVASKQKKT FDVINPSNEE KITTVYKAME DDVDEAVAAA KKAFETKWSI

     101  VEPEVRAKAL FNLADLVEKH QETLAAIESM DNGKSLFCAR GDVALVSKYL

     151  RSCGGWADKI YGNVIDTGKN HFTYSIKEPL GVCGQIIPWN FPLLMWSWKI

     201  GPALATGNTV VLKPAETTPL SALFASQLCQ EAGIPAGVVN ILPGSGRVVG

     251  ERLSAHPDVK KIAFTGSTAT GRHIMKVAAD TVKKVTLELG GKSPNIVFAD

     301  ADLDKAVKNI AFGIFYNSGE VCCAGSRIYI QDTVYEEVLQ KLKDYTESLK

     351  VGDPFDEEVF QGAQTSDKQL HKILDYVDVA KSEGARLVTG GARHGSKGYF

     401  VKPTVFADVK EDMRIVKEEV FGPIVTVSKF STVDEVIAMA NDSQYGLAAG

     451  IHTNDINKAV DVSKRVKAGT VWINTYNNFH QNVPFGGFGQ SGIGREMGEA

     501  ALSNYTQTKS VRIAIDKPIR *

Protein Sequence for MIT_Smik_c616_6610:

MIT_Smik_c616_6610  Length: 521  Mon Nov  7 15:15:12 2016  Type: P  Check: 3608  ..

       1  MFSRTRATTL NSNSFARNLL RLYSQVPLRV PITLPNGFTY EQPTGLFING

      51  EFVASKQKKT FDVINPSNEE KITTVYKAME DDVDTAVAAA KKAFETKWSI

     101  VEPEVRAKAL FKLADLVEEN KETLAAIESM DNGKSLFCAR GDVALVSKYL

     151  RSCGGWADKI YGNVIDTGRD HFTYSMKEPL GVCGQIIPWN FPLLMWSWKI

     201  GPALATGNTV VLKPAETTPL SALFASQLCQ EAGIPAGVVN ILPGSGRVVG

     251  EKLSAHPDVK KIAFTGSTAT GRHIMKVAAD TVKKVTLELG GKSPNIVFAD

     301  ADINKAVENI AFGIFYNSGE VCCAGSRIYI QDTVYEEVLE KLKDYTESLK

     351  VGDPFNEEVF QGAQTSEKQL HKILEYVDVA KSEGARLVTG GVRHGNKGFF

     401  VKPTVFADVK EDMRIVKEEV FGPIVTVSKF STVDDVIAMA NDSQYGLAAG

     451  IHTNDINKAI DVSKRVKAGT VWVNTYNNFH QNVPFGGFGQ SGIGREMGEA

     501  ALSNYTQTKS VRIAIDRPVR *

Protein Sequence for MIT_Spar_c421_6331:

MIT_Spar_c421_6331  Length: 521  Mon Nov  7 15:15:12 2016  Type: P  Check: 5355  ..

       1  MLSRTRATAL NSNLFSRNLL RLYSQAPLRV PITLPNGHTY EQPTGLFING

      51  EFVASKQRKT FDVINPSNEE KITTVYKAME DDVDTAVAAA KKAFDTKWSI

     101  VEPEVRAKAL FNLADLVEKN QETLAAIESM DNGKSLFCAR GDVALVSKYL

     151  RSCGGWADKI YGNVIDTGRD HFTYSIKEPL GVCGQIIPWN FPLLMWSWKI

     201  GPALATGNTV VLKPAETTPL SALFASQLCQ EAGIPAGVVN ILPGSGRVVG

     251  ERLSVHPDVK KIAFTGSTAT GRHIMKVAAD TVKKVTLELG GKSPNIVFAD

     301  ADLDKAVQNI AFGIFYNSGE VCCAGSRIYI QDTVYEEVLQ KLKEYTESLK

     351  VGDPFNEEVF QGAQTSDKQL HKILKYVDVA KSEGARLVTG GVRHGSKGYF

     401  VKPTVFADVK EDMRIVKEEV FGPIVTVSKF STADEVIAMA NNSEYGLAAG

     451  IHTNDINKAV DVSKRVKAGT VWINTYNNFH QNVPFGGFGQ SGIGREMGEA

     501  ALSNYTQTKS VRIAIDKPIR *

Protein Sequence for MIT_Suva_c371_6986:

MIT_Suva_c371_6986  Length: 521  Mon Nov  7 15:15:12 2016  Type: P  Check: 3783  ..

       1  MFSRTRTTAL KSNSFARNLL RLYSQAPLHV PITLPNGLTY EQPTGLFING

      51  EFVASKQKKT FDVINPSTEE KITTVYKAME DDVDTAVAAA KKAFETKWSI

     101  VEPEVRARAL FNLADLVEKN QETLAAIESM DNGKSLFCSR GDVALVSKYL

     151  RSCGGWADKL NGNVIDTGKD HFTYSVKEPL GVCGQIIPWN FPLLMWSWKI

     201  GPALATGNTV VLKPAETTPL SALFASQLCQ EAGIPAGVVN ILPGSGRVVG

     251  ERLSAHPDVK KIAFTGSTAT GRHIMKVAAD TVKKVTLELG GKSPNIVFAD

     301  ADLDKAVKNI AFGIFFNSGE VCCAGSRIYI QDTVYEEVLK KLKEYTETLK

     351  VGDPFNEEVF QGAQTSDKQL HKILDYVKVA KSEGARLVTG GERQGDKGYF

     401  IKPTIFADVK EDMRIVKEEV FGPIVTVSKF STVDEVIAMA NDSQYGLAAG

     451  IHTNDINKAI NVSNRVKAGT VWVNTYNNFH QNVPFGGFGQ SGIGREMGDA

     501  ALSNYTQVKS VRMAIDKPIR *

Protein Sequence for WashU_Sbay_Contig677.89:

WashU_Sbay_Contig677.89  Length: 521  Mon Nov  7 15:15:12 2016  Type: P  Check: 3783  ..

       1  MFSRTRTTAL KSNSFARNLL RLYSQAPLHV PITLPNGLTY EQPTGLFING

      51  EFVASKQKKT FDVINPSTEE KITTVYKAME DDVDTAVAAA KKAFETKWSI

     101  VEPEVRARAL FNLADLVEKN QETLAAIESM DNGKSLFCSR GDVALVSKYL

     151  RSCGGWADKL NGNVIDTGKD HFTYSVKEPL GVCGQIIPWN FPLLMWSWKI

     201  GPALATGNTV VLKPAETTPL SALFASQLCQ EAGIPAGVVN ILPGSGRVVG

     251  ERLSAHPDVK KIAFTGSTAT GRHIMKVAAD TVKKVTLELG GKSPNIVFAD

     301  ADLDKAVKNI AFGIFFNSGE VCCAGSRIYI QDTVYEEVLK KLKEYTETLK

     351  VGDPFNEEVF QGAQTSDKQL HKILDYVKVA KSEGARLVTG GERQGDKGYF

     401  IKPTIFADVK EDMRIVKEEV FGPIVTVSKF STVDEVIAMA NDSQYGLAAG

     451  IHTNDINKAI NVSNRVKAGT VWVNTYNNFH QNVPFGGFGQ SGIGREMGDA

     501  ALSNYTQVKS VRMAIDKPIR *

Protein Sequence for WashU_Scas_Contig701.14:

WashU_Scas_Contig701.14  Length: 516  Mon Nov  7 15:15:12 2016  Type: P  Check: 1845  ..

       1  MFSRTITPRV ISRRVIRLYS QLPLRVPVTL PNGLKYEQPT GLFINGDFVP

      51  SKQNKIFEVI NPSTEEVITP VYEAMEDDVD IAVAAAKKAF KSWSIADPEV

     101  RASALFKLAN LVEKNAELLA SIETADNGKS LLCSRGDVAL VSKYLRSCGG

     151  WADKINGNVI NTGDNHFAYT TREPLGVCGQ IIPWNFPLLM WSWKIGPALA

     201  TGNTVVLKPA ETTPLSALFA SQLCIEAGIP KGVVNIIPGS GRVVGEKLCK

     251  HPDVKKIAFT GSTKTGSHIM KTAADTVKKV TLELGGKSPN IVFADADLDK

     301  AIENIAFGIF YNSGEVCCAG SRIYVQDTVY DTVLNKFKKY TENLKVGDPF

     351  DESTFQGAQT SKAQLTKILK YVKVGTDEGA RVVTGGERFG NKGYFVKPTI

     401  FADVKEDMQI VKEEVFGPLV TISKFSTVDE VIDMANDSQY GLAAGIHTKD

     451  VNKAIHVSKR IQAGTVWINT YNAFHQNVPF GGFGQSGIGR EMGAAALDNY

     501  TQVKSVRMAI EKPEY*

Protein Sequence for WashU_Sklu_Contig2369.5:

WashU_Sklu_Contig2369.5  Length: 515  Mon Nov  7 15:15:12 2016  Type: P  Check: 5881  ..

       1  MLARSQITTL RRFVRLYSNL PLRVPVTLPN GITYEQPTGL FINGEFVPSR

      51  QHKTFEVINP SNEEEVTHVY EAREDDVDIA VAAAKKAFDN GWSTAEPEFR

     101  AQCLYKLADL IEKNAETLAG IESLDNGKSL FCSRGDVALV SKYLRSCAGW

     151  SDKLFGKVID TGSDHFAYTK REPLGVCGQI IPWNFPLLMW SWKIGPALAT

     201  GNTVVLKPAE ATPLSALYAS QLCQEAGIPK GVVNIIPGFG KIVGERLCTH

     251  PEVKKVAFTG STATGRHIMK TAADSIKKVT LELGGKSPNI VFGDADLDKA

     301  VKNIAFGIFF NSGEVCCAGS RVYVQDTVYE EVLQKFKEYT ESLKVGNPFE

     351  DGVFQGAQTS KMQIDKILSY VDIGTKEGAR IITGGEKKGE KGYFIKPTIF

     401  ADVKEDMRIV KEEIFGPIVS VSKFSSVDEV IAMANDSEYG LAAGIHTKDV

     451  NKAIDVSNRI KAGTIWINTY NAFHQSVPFG GFGQSGIGRE MGAEALDNYT

     501  QVKAVRMAID KAQY*

Protein Sequence for WashU_Skud_Contig1843.6:

WashU_Skud_Contig1843.6  Length: 521  Mon Nov  7 15:15:12 2016  Type: P  Check: 4734  ..

       1  MFSRTRSVAL NSNSFTRNLL RLYSQAPLRV PITLPNGFTY EQPTGLFING

      51  EFVASKQQKT FDVINPSTEE KITTVYKAME DDVDVAVAAA KKAFETKWSI

     101  VEPEVRAKAL FNLADLVEKN QETLAAIESM DNGKSLFCAR GDVALVSKYL

     151  RSCGGWADKI YGNVIDTGKD HFTYSVREPL GVCGQIIPWN FPLLMWSWKI

     201  GPALATGNTV VLKPAETTPL SALFASQLCQ EAGIPAGVVN ILPGSGRVVG

     251  EKLSAHPDVK KIAFTGSTAT GRHIMKVAAD TVKKVTLELG GKSPNIVFAD

     301  ADLDKAVKNI AFGIFFNSGE VCCAGSRIYI QDTVYEDVLQ KLKSYTESLK

     351  VGDPFNEDNF QGAQTSDKQL HKILDYVAVA KSEGARLVTG GVRHGNKGYF

     401  VKPTVFADVK EDMRIVKEEV FGPIVTVSKF STVDEVIAMA NNSQYGLAAG

     451  IHTNDINKAI DVSNRVKAGT VWVNTYNNFH QSVPFGGFGQ SGIGREMGEA

     501  ALSNYTQTKS VRIAIDKPIR *

Protein Sequence for WashU_Smik_Contig2898.7:

WashU_Smik_Contig2898.7  Length: 521  Mon Nov  7 15:15:12 2016  Type: P  Check: 3608  ..

       1  MFSRTRATTL NSNSFARNLL RLYSQVPLRV PITLPNGFTY EQPTGLFING

      51  EFVASKQKKT FDVINPSNEE KITTVYKAME DDVDTAVAAA KKAFETKWSI

     101  VEPEVRAKAL FKLADLVEEN KETLAAIESM DNGKSLFCAR GDVALVSKYL

     151  RSCGGWADKI YGNVIDTGRD HFTYSMKEPL GVCGQIIPWN FPLLMWSWKI

     201  GPALATGNTV VLKPAETTPL SALFASQLCQ EAGIPAGVVN ILPGSGRVVG

     251  EKLSAHPDVK KIAFTGSTAT GRHIMKVAAD TVKKVTLELG GKSPNIVFAD

     301  ADINKAVENI AFGIFYNSGE VCCAGSRIYI QDTVYEEVLE KLKDYTESLK

     351  VGDPFNEEVF QGAQTSEKQL HKILEYVDVA KSEGARLVTG GVRHGNKGFF

     401  VKPTVFADVK EDMRIVKEEV FGPIVTVSKF STVDDVIAMA NDSQYGLAAG

     451  IHTNDINKAI DVSKRVKAGT VWVNTYNNFH QNVPFGGFGQ SGIGREMGEA

     501  ALSNYTQTKS VRIAIDRPVR *