Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YER048C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_CAJ1/YER048C   1   MVKETEYYDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPDAQAKFQA   50
MIT_Smik_c283_6053   1   MVKETEYYDILGIKPEATSTEIKKAYRRKAMETHPDKHPDDPDAQAKFQA   50
MIT_Spar_c424_6219   1   MVKETEYYDILGIKPEATSTEIKKAYRRKAMETHPDKHPDDPDAQAKFQA   50
MIT_Suva_c82_6267   1   MVKETEYYDILGIKPEATATEIKKAYRRKAMETHPDKHPDDPDAQAKFQA   50
WashU_Sbay_Contig609.22   1   MVKETEYYDILGIKPEATATEIKKAYRRKAMETHPDKHPDDPDAQAKFQA   50
WashU_Scas_Contig715.29   1   MVKDTGYYDVLGVQPTATPAEIKKAYRRRAMQTHPDKHPDDPEAQAKFQE   50
WashU_Sklu_Contig2174.6   1   MVKDTEYYDALGISPDATPTEIKKAYRKKAMLTHPDKHPNDPDAQAKFQA   50
Symbols






***:* *** **:.* **.:*******::** *******:**:******



SGD_Scer_CAJ1/YER048C   51   VGEAYQVLSDPGLRSKYDQFGKEDAVPQQGFEDASEYFTAIFGGDGFKDW   100
MIT_Smik_c283_6053   51   VGEAYQVLSDPGLRSKYDEFGKEDAVPQQGFEDASEYFTAIFGGDGFKNW   100
MIT_Spar_c424_6219   51   VGEAYQVLSDPGLRSKYDQFGKEDAVPQQGFEDASEYFTAIFGGDGFKDW   100
MIT_Suva_c82_6267   51   VGEAYQVLSDQGLRSKYDEFGKEDAVPQQGFEDASEYFTAIFGGDGFKDW   100
WashU_Sbay_Contig609.22   51   VGEAYQVLSDQGLRSKYDEFGKEDAVPQQGFEDASEYFTAIFGGDGFKDW   100
WashU_Scas_Contig715.29   51   VGEAYQVLSDPGLRSRYDEFGKDEAVPQQGFEDANEYFTAIFGGDGFKDW   100
WashU_Sklu_Contig2174.6   51   VGQAYQVLSDPGLRSRYDEFGKDDAVPQQGFEDAGEFFTTIFGGDGFSDW   100
Symbols






**:******* ****:**:***::**********.*:**:*******.:*



SGD_Scer_CAJ1/YER048C   101   IGEFSLFKELNEATEMFGKED-----EEGTAATETEKADESTDGGMVKHD   145
MIT_Smik_c283_6053   101   IGEFSLFKELNEATEMLGKDD-----DEANAANNTGKADETTDGGMVKHD   145
MIT_Spar_c424_6219   101   IGEFSLFKELNEATEMFGKED-----EEGTAATGTEKADETTDGGMVKHD   145
MIT_Suva_c82_6267   101   IGEFSLFKELGEATEMLEKED-----EEGTAATHTDKGDETSDSGIVKHD   145
WashU_Sbay_Contig609.22   101   IGEFSLFKELGEATEMLEKED-----EEGTAATHTDKGDETSDSGIVKHD   145
WashU_Scas_Contig715.29   101   IGEFSLFKEFNEASEMFDEKN-----DDMTNKPQSE------HTGVIPHE   139
WashU_Sklu_Contig2174.6   101   IGEFSLLKDMTKSADIFGDEEQSESPEDATTDQKADAQEGETSADVVQHN   150
Symbols






******:*:: :::::: ..: :: . : .:: *:



SGD_Scer_CAJ1/YER048C   146   TNKAESLKKDKLSKEQREKLMEMEKKRREDMMKQVDELAEKLNEKISRYL   195
MIT_Smik_c283_6053   146   SDKAESLKKDKLSKEQREKLLEMERKRREDMMKQVDELAEKLNEKISRYL   195
MIT_Spar_c424_6219   146   ANKAESLKKDKLSKEQREKLMEMEKKRREDMMKQVDELAEKLNEKISRYL   195
MIT_Suva_c82_6267   146   GNKAEYMRKDRLSKEQRKKLLEMERKRREDMMKQVDELAVKLNEKISRYL   195
WashU_Sbay_Contig609.22   146   GNKAEYMRKDRLSKEQRKKLLEMERKRREDMMKQVDELAVKLNEKISRYL   195
WashU_Scas_Contig715.29   140   GDKPG-KKADKMTKEQREKLLELEKKRREEMSKQVDELSKKLNAKIDEYL   188
WashU_Sklu_Contig2174.6   151   GKRDDKKKSNKLTKEQREKLVEMEMERRAEKKKQVEELTKKLDVKLTDYN   200
Symbols






.: : ::::****:**:*:* :** : ***:**: **: *: *



SGD_Scer_CAJ1/YER048C   196   IAVKSNNLEEFTRKLDQEIEDLKLESFGLELLYLLARVYKTKANNFIMSK   245
MIT_Smik_c283_6053   196   IAIKSNNLEEFTRKLDQEIEDLKLESFGLELLYLLARVYKTKANNFIMSK   245
MIT_Spar_c424_6219   196   IAVKSNNLEEFTRKLDQEIEDLKLESFGLELLYLLARVYKTKANNFIMSK   245
MIT_Suva_c82_6267   196   IAVKANNLEEFTRKLDQEIEDLKLESFGLELLYLLARVYKTKANNFIMSK   245
WashU_Sbay_Contig609.22   196   IAVKANNLEEFTRKLDQEIEDLKLESFGLELLYLLARVYKTKANNFIMSK   245
WashU_Scas_Contig715.29   189   IAVKENHLDDFVRKLDQEIEELKLESFGLELLYLIAKVYKTKANNFIISK   238
WashU_Sklu_Contig2174.6   201   LALKNHNLDEFTAKLQQEIEDLKLESFGLELLHLIAKIYRTKANNFIMSQ   250
Symbols






:*:* ::*::*. **:****:***********:*:*::*:*******:*:



SGD_Scer_CAJ1/YER048C   246   KTYGISKIFTGTRDNARSVKSAYNLLSTGLEAQKAMEKMSEVNTDELDQY   295
MIT_Smik_c283_6053   246   RTYGFSKIFTGTRDNARSVKSAYNLLSTGLEAQKAMEKMSEVNTDELDQY   295
MIT_Spar_c424_6219   246   KTYGISKIFTGTRDNARSVKSAYNLLSTGLEAQKAMEKMSEVNTDELDQY   295
MIT_Suva_c82_6267   246   KTYGFSKIFTNTRDNARSVKSAYNLLSTGLEAQKAMEKMNEVNPDELDQY   295
WashU_Sbay_Contig609.22   246   KTYGFSKIFTNTRDNARSVKSAYNLLSTGLEAQKAMEKMNEVNPDELDQY   295
WashU_Scas_Contig715.29   239   KTYGFSRIFTGTRENARTVKSTYNLLSTGLETQKAMEEMSKVNPDELDAY   288
WashU_Sklu_Contig2174.6   251   KTHGISKIFTGVRDKTKTAKSAWGILSSAMDAQSAMKELEKLDMDTMDDY   300
Symbols






:*:*:*:***..*:::::.**::.:**:.:::*.**:::.::: * :* *



SGD_Scer_CAJ1/YER048C   296   ERAKFESTMAGKALGVMWAMSKFELERKLKDVCNKILNDKKVPSKERIAK   345
MIT_Smik_c283_6053   296   ERAKFESTMAGKALGVMWAMSKFELERKLKDVCNKILNDKKVPSKERIAK   345
MIT_Spar_c424_6219   296   ERAKFESTMAGKALGVMWAMSKFELERKLKDVCNKILNDKKVSSKERIAK   345
MIT_Suva_c82_6267   296   ERAKFESTLAGKALGVMWAMSKFELERKLKDVCNQILNDRKVSSKERIAK   345
WashU_Sbay_Contig609.22   296   ERAKFESTLAGKALGVMWAMSKFELERKLKDVCNQILNDRKVSSKERIAK   345
WashU_Scas_Contig715.29   289   ERVKFESMMAGKALGMMWVMSKFELERKLKDVCSAILNDKKVPSKIRIAK   338
WashU_Sklu_Contig2174.6   301   ERAEMEKFITGKVLGTAWVMSKFEVQGKLKDVCDKILTDKTLSSKERLGK   350
Symbols






**.::*. ::**.** *.*****:: ******. **.*:.:.** *:.*



SGD_Scer_CAJ1/YER048C   346   AKAMLFIAHKFASARRSPEEAEEARVFEELILGEQEKEHKKHTVAR---   391
MIT_Smik_c283_6053   346   AKAMLFIAHKFASARRSPEEAEEARVFEELILGEQEKEHKKHTVAR---   391
MIT_Spar_c424_6219   346   AKAMLFIAHKFASARRSPEEAEEARVFEELILGEQEKEHKKHTVAR---   391
MIT_Suva_c82_6267   346   AKAMLFIANKFASARRSPEEAEEARVFEELILGEQEKEHKRHVVIK---   391
WashU_Sbay_Contig609.22   346   AKAMLFIANKFASARRSPEEAEEARVFEELILGEQEKEHKRHVVIK---   391
WashU_Scas_Contig715.29   339   AKAMLFIADKFSKARRTPEEAEEARVFEELILGEQEKERKRGIKIKVTI   387
WashU_Sklu_Contig2174.6   351   AKALLFIADKFAAARRSPDEAEDARVFEELIFEAKDKKSKNKK------   393
Symbols






***:****.**: ***:*:***:********: ::*: *.



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_CAJ1/YER048C:

SGD_Scer_CAJ1/YER048C  Length: 392  Mon Nov  7 15:14:38 2016  Type: P  Check: 7140  ..

       1  MVKETEYYDI LGIKPEATPT EIKKAYRRKA METHPDKHPD DPDAQAKFQA

      51  VGEAYQVLSD PGLRSKYDQF GKEDAVPQQG FEDASEYFTA IFGGDGFKDW

     101  IGEFSLFKEL NEATEMFGKE DEEGTAATET EKADESTDGG MVKHDTNKAE

     151  SLKKDKLSKE QREKLMEMEK KRREDMMKQV DELAEKLNEK ISRYLIAVKS

     201  NNLEEFTRKL DQEIEDLKLE SFGLELLYLL ARVYKTKANN FIMSKKTYGI

     251  SKIFTGTRDN ARSVKSAYNL LSTGLEAQKA MEKMSEVNTD ELDQYERAKF

     301  ESTMAGKALG VMWAMSKFEL ERKLKDVCNK ILNDKKVPSK ERIAKAKAML

     351  FIAHKFASAR RSPEEAEEAR VFEELILGEQ EKEHKKHTVA R*


Protein Sequence for MIT_Smik_c283_6053:

MIT_Smik_c283_6053  Length: 392  Mon Nov  7 15:14:38 2016  Type: P  Check: 7145  ..

       1  MVKETEYYDI LGIKPEATST EIKKAYRRKA METHPDKHPD DPDAQAKFQA

      51  VGEAYQVLSD PGLRSKYDEF GKEDAVPQQG FEDASEYFTA IFGGDGFKNW

     101  IGEFSLFKEL NEATEMLGKD DDEANAANNT GKADETTDGG MVKHDSDKAE

     151  SLKKDKLSKE QREKLLEMER KRREDMMKQV DELAEKLNEK ISRYLIAIKS

     201  NNLEEFTRKL DQEIEDLKLE SFGLELLYLL ARVYKTKANN FIMSKRTYGF

     251  SKIFTGTRDN ARSVKSAYNL LSTGLEAQKA MEKMSEVNTD ELDQYERAKF

     301  ESTMAGKALG VMWAMSKFEL ERKLKDVCNK ILNDKKVPSK ERIAKAKAML

     351  FIAHKFASAR RSPEEAEEAR VFEELILGEQ EKEHKKHTVA R*


Protein Sequence for MIT_Spar_c424_6219:

MIT_Spar_c424_6219  Length: 392  Mon Nov  7 15:14:38 2016  Type: P  Check: 6800  ..

       1  MVKETEYYDI LGIKPEATST EIKKAYRRKA METHPDKHPD DPDAQAKFQA

      51  VGEAYQVLSD PGLRSKYDQF GKEDAVPQQG FEDASEYFTA IFGGDGFKDW

     101  IGEFSLFKEL NEATEMFGKE DEEGTAATGT EKADETTDGG MVKHDANKAE

     151  SLKKDKLSKE QREKLMEMEK KRREDMMKQV DELAEKLNEK ISRYLIAVKS

     201  NNLEEFTRKL DQEIEDLKLE SFGLELLYLL ARVYKTKANN FIMSKKTYGI

     251  SKIFTGTRDN ARSVKSAYNL LSTGLEAQKA MEKMSEVNTD ELDQYERAKF

     301  ESTMAGKALG VMWAMSKFEL ERKLKDVCNK ILNDKKVSSK ERIAKAKAML

     351  FIAHKFASAR RSPEEAEEAR VFEELILGEQ EKEHKKHTVA R*


Protein Sequence for MIT_Suva_c82_6267:

MIT_Suva_c82_6267  Length: 392  Mon Nov  7 15:14:38 2016  Type: P  Check: 8543  ..

       1  MVKETEYYDI LGIKPEATAT EIKKAYRRKA METHPDKHPD DPDAQAKFQA

      51  VGEAYQVLSD QGLRSKYDEF GKEDAVPQQG FEDASEYFTA IFGGDGFKDW

     101  IGEFSLFKEL GEATEMLEKE DEEGTAATHT DKGDETSDSG IVKHDGNKAE

     151  YMRKDRLSKE QRKKLLEMER KRREDMMKQV DELAVKLNEK ISRYLIAVKA

     201  NNLEEFTRKL DQEIEDLKLE SFGLELLYLL ARVYKTKANN FIMSKKTYGF

     251  SKIFTNTRDN ARSVKSAYNL LSTGLEAQKA MEKMNEVNPD ELDQYERAKF

     301  ESTLAGKALG VMWAMSKFEL ERKLKDVCNQ ILNDRKVSSK ERIAKAKAML

     351  FIANKFASAR RSPEEAEEAR VFEELILGEQ EKEHKRHVVI K*


Protein Sequence for WashU_Sbay_Contig609.22:

WashU_Sbay_Contig609.22  Length: 392  Mon Nov  7 15:14:38 2016  Type: P  Check: 8543  ..

       1  MVKETEYYDI LGIKPEATAT EIKKAYRRKA METHPDKHPD DPDAQAKFQA

      51  VGEAYQVLSD QGLRSKYDEF GKEDAVPQQG FEDASEYFTA IFGGDGFKDW

     101  IGEFSLFKEL GEATEMLEKE DEEGTAATHT DKGDETSDSG IVKHDGNKAE

     151  YMRKDRLSKE QRKKLLEMER KRREDMMKQV DELAVKLNEK ISRYLIAVKA

     201  NNLEEFTRKL DQEIEDLKLE SFGLELLYLL ARVYKTKANN FIMSKKTYGF

     251  SKIFTNTRDN ARSVKSAYNL LSTGLEAQKA MEKMNEVNPD ELDQYERAKF

     301  ESTLAGKALG VMWAMSKFEL ERKLKDVCNQ ILNDRKVSSK ERIAKAKAML

     351  FIANKFASAR RSPEEAEEAR VFEELILGEQ EKEHKRHVVI K*


Protein Sequence for WashU_Scas_Contig715.29:

WashU_Scas_Contig715.29  Length: 388  Mon Nov  7 15:14:38 2016  Type: P  Check: 4640  ..

       1  MVKDTGYYDV LGVQPTATPA EIKKAYRRRA MQTHPDKHPD DPEAQAKFQE

      51  VGEAYQVLSD PGLRSRYDEF GKDEAVPQQG FEDANEYFTA IFGGDGFKDW

     101  IGEFSLFKEF NEASEMFDEK NDDMTNKPQS EHTGVIPHEG DKPGKKADKM

     151  TKEQREKLLE LEKKRREEMS KQVDELSKKL NAKIDEYLIA VKENHLDDFV

     201  RKLDQEIEEL KLESFGLELL YLIAKVYKTK ANNFIISKKT YGFSRIFTGT

     251  RENARTVKST YNLLSTGLET QKAMEEMSKV NPDELDAYER VKFESMMAGK

     301  ALGMMWVMSK FELERKLKDV CSAILNDKKV PSKIRIAKAK AMLFIADKFS

     351  KARRTPEEAE EARVFEELIL GEQEKERKRG IKIKVTI*

Protein Sequence for WashU_Sklu_Contig2174.6:

WashU_Sklu_Contig2174.6  Length: 394  Mon Nov  7 15:14:38 2016  Type: P  Check: 5151  ..

       1  MVKDTEYYDA LGISPDATPT EIKKAYRKKA MLTHPDKHPN DPDAQAKFQA

      51  VGQAYQVLSD PGLRSRYDEF GKDDAVPQQG FEDAGEFFTT IFGGDGFSDW

     101  IGEFSLLKDM TKSADIFGDE EQSESPEDAT TDQKADAQEG ETSADVVQHN

     151  GKRDDKKKSN KLTKEQREKL VEMEMERRAE KKKQVEELTK KLDVKLTDYN

     201  LALKNHNLDE FTAKLQQEIE DLKLESFGLE LLHLIAKIYR TKANNFIMSQ

     251  KTHGISKIFT GVRDKTKTAK SAWGILSSAM DAQSAMKELE KLDMDTMDDY

     301  ERAEMEKFIT GKVLGTAWVM SKFEVQGKLK DVCDKILTDK TLSSKERLGK

     351  AKALLFIADK FAAARRSPDE AEDARVFEEL IFEAKDKKSK NKK*