Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YEL065W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_SIT1/YEL065W   1   MDPGIANHTLPEEFEEVVVPEMLEKEVGAKVDVKPTLTTSSPAPSYIELI   50
MIT_Smik_c202_5644   1   MDPATANHALPEDFTEDVVPDILEKEVGAIVDVNPTLTTSSPAPSYIELI   50
MIT_Spar_c356_5984   1   MDPATANHTLTEEFTEVVVPEMLEKEAAATVDVNPTLTTSSPAPSYIELI   50
MIT_Suva_c280_5966   1   MDPATANRALPEEFTEVVVPEILEKEVGTTTAAGPALTTSSPAPSYIELI   50
WashU_Sbay_Contig676.52   1   MDPATANRALPEEFTEVVVPEILEKEVGTTTAAGPALTTSSPAPSYIELI   50
WashU_Scas_Contig514.3   1   ----MSSVSTTDQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSEESVK   46
Symbols






:. : .:: . : .: :: . . .: .* .: * .:



SGD_Scer_SIT1/YEL065W   51   DPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATS   100
MIT_Smik_c202_5644   51   DPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATS   100
MIT_Spar_c356_5984   51   DPGVHNIEIYAEMYNHPVYRVALFFSLFLIAYAYGLDGNIRYTFQAYATS   100
MIT_Suva_c280_5966   51   DPGVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATS   100
WashU_Sbay_Contig676.52   51   DPGVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATS   100
WashU_Scas_Contig514.3   47   DAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATS   96
Symbols






*.** ******* *..*. *. ****:**:********.******* ***



SGD_Scer_SIT1/YEL065W   101   SYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGT   150
MIT_Smik_c202_5644   101   SYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGT   150
MIT_Spar_c356_5984   101   SYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGT   150
MIT_Suva_c280_5966   101   SYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGT   150
WashU_Sbay_Contig676.52   101   SYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGT   150
WashU_Scas_Contig514.3   97   SYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGT   146
Symbols






***:****************.***:*** ******::*: :*:*** :**



SGD_Scer_SIT1/YEL065W   151   IIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIP   200
MIT_Smik_c202_5644   151   IIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIP   200
MIT_Spar_c356_5984   151   IIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIP   200
MIT_Suva_c280_5966   151   IIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNWRLLALFVP   200
WashU_Sbay_Contig676.52   151   IIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNWRLLALFVP   200
WashU_Scas_Contig514.3   147   VIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIP   196
Symbols






:*****..::**:.******** ** :**:*:**:*************:*



SGD_Scer_SIT1/YEL065W   201   ALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGICMLHMRYL   250
MIT_Smik_c202_5644   201   ALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICMLHMRYL   250
MIT_Spar_c356_5984   201   ALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRYL   250
MIT_Suva_c280_5966   201   ALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRYL   250
WashU_Sbay_Contig676.52   201   ALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRYL   250
WashU_Scas_Contig514.3   197   ALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLHMRYL   246
Symbols






*****:******:**:*:. ************:*******. ********



SGD_Scer_SIT1/YEL065W   251   ARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV   300
MIT_Smik_c202_5644   251   ARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV   300
MIT_Spar_c356_5984   251   ARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV   300
MIT_Suva_c280_5966   251   ARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLV   300
WashU_Sbay_Contig676.52   251   ARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLV   300
WashU_Scas_Contig514.3   247   AHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLI   296
Symbols






*:*:***:* *.* :.:. *.: **: **:**:**:**:. ******:



SGD_Scer_SIT1/YEL065W   301   PFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLI   350
MIT_Smik_c202_5644   301   PFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLI   350
MIT_Spar_c356_5984   301   PFTLAGGLKEEWRTAHIIVPEVIGWVVVLPLYMIWEMKYSRHPLTPWDLL   350
MIT_Suva_c280_5966   301   PFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLI   350
WashU_Sbay_Contig676.52   301   PFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLI   350
WashU_Scas_Contig514.3   297   PFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELL   346
Symbols






*******:**:*::*********** *.****::**:*:********:*:



SGD_Scer_SIT1/YEL065W   351   QDRGIFFALLIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSF   400
MIT_Smik_c202_5644   351   KDRGIFFALLIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSF   400
MIT_Spar_c356_5984   351   QDRGIFFALLIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSF   400
MIT_Suva_c280_5966   351   KDRGVLFALFIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITALYSF   400
WashU_Sbay_Contig676.52   351   KDRGVLFALFIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITALYSF   400
WashU_Scas_Contig514.3   347   KDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSF   396
Symbols






:***: **:***:*** ************:******:*:*****:****



SGD_Scer_SIT1/YEL065W   401   VSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGI   450
MIT_Smik_c202_5644   401   VSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGI   450
MIT_Spar_c356_5984   401   VSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGI   450
MIT_Suva_c280_5966   401   VSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGI   450
WashU_Sbay_Contig676.52   401   VSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGI   450
WashU_Scas_Contig514.3   397   VSVITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGI   446
Symbols






****.*****::*:*:*******:***. *::*****:*********:**



SGD_Scer_SIT1/YEL065W   451   IGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIGSAFG   500
MIT_Smik_c202_5644   451   IGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIGSAFG   500
MIT_Spar_c356_5984   451   IGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIGSAFG   500
MIT_Suva_c280_5966   451   IGSLCLLGFGAGSFTYVTQASIQASAGTHARMAIVTSLYLATYNIGSAFG   500
WashU_Sbay_Contig676.52   451   IGSLCLLGFGAGSFTYVTQASIQASAGTHARMAIVTSLYLATYNIGSAFG   500
WashU_Scas_Contig514.3   447   IGSLCLLGFCAGFFTYTTQTSIQATTRSHAKMAVITALYLACYNIGSSFG   496
Symbols






********* ** ***.**:****:: :**:**::*:**** *****:**



SGD_Scer_SIT1/YEL065W   501   SSVSGAVWTNILPKEISKRISDPTLAAQAYGSPFTFITTYTWGTPERIAL   550
MIT_Smik_c202_5644   501   SSVSGAVWTNILPKEISKRISDPTLAAQAYSAPFTFITTYTWGTPERIAL   550
MIT_Spar_c356_5984   501   SSVSGAVWTNILPKEISKRISDPTLAAQAYGSPFTFITTYTWGTPERIAL   550
MIT_Suva_c280_5966   501   SSVSGAVWTNILPKEISKRISDPTLAAEAYGSPFTFITTYTWGTPERIAL   550
WashU_Sbay_Contig676.52   501   SSVSGAVWTNILPKEISKRISDPTLAAEAYGSPFTFITTYTWGTPERIAL   550
WashU_Scas_Contig514.3   497   AAVSGGVWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAERQAV   546
Symbols






::***.****:**..**: **: ****:**.:***** **** *.** *:



SGD_Scer_SIT1/YEL065W   551   VMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESKN   600
MIT_Smik_c202_5644   551   VMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLKSKD   600
MIT_Spar_c356_5984   551   VMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESRN   600
MIT_Suva_c280_5966   551   VMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALEGNDHLESKN   600
WashU_Sbay_Contig676.52   551   VMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALEGNDHLESKN   600
WashU_Scas_Contig514.3   547   VKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVED   596
Symbols






* :** .************.*** .* ***:*:* * :**: .. .:



SGD_Scer_SIT1/YEL065W   601   TFEIEEKEESFLKNKFFTHFTSSKDRKD----------   628
MIT_Smik_c202_5644   601   SFETEEKQESFLKSMIFTRFTRSEDKRN----------   628
MIT_Spar_c356_5984   601   SSETEEKEESFLKSKFFTQFTSSKGKEN----------   628
MIT_Suva_c280_5966   601   DNEIVEKEETSLRTRFLAQFTSKEKKN-----------   627
WashU_Sbay_Contig676.52   601   DNEIVEKEETSLRTRFLAQFTSKEKKN-----------   627
WashU_Scas_Contig514.3   597   DDPIFAFLKKCIPFYNKKNGETSTVTTSTDGNDVVEMV   634
Symbols






:. : . .



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_SIT1/YEL065W:

SGD_Scer_SIT1/YEL065W  Length: 629  Mon Nov  7 15:13:15 2016  Type: P  Check: 3003  ..

       1  MDPGIANHTL PEEFEEVVVP EMLEKEVGAK VDVKPTLTTS SPAPSYIELI

      51  DPGVHNIEIY AEMYNRPIYR VALFFSLFLI AYAYGLDGNI RYTFQAYATS

     101  SYSQHSLLST VNCIKTVIAA VGQIFFARLS DIFGRFSIMI VSIIFYSMGT

     151  IIESQAVNIT RFAVGGCFYQ LGLTGIILIL EVIASDFSNL NWRLLALFIP

     201  ALPFIINTWI SGNVTSAIDA NWKWGIGMWA FILPLACIPL GICMLHMRYL

     251  ARKHAKDRLK PEFEALNKLK WKSFCIDIAF WKLDIIGMLL ITVFFGCVLV

     301  PFTLAGGLKE EWKTAHIIVP EVIGWVVVLP LYMLWEIKYS RHPLTPWDLI

     351  QDRGIFFALL IAFFINFNWY MQGDYMYTVL VVAVHESIKS ATRITSLYSF

     401  VSVIVGTILG FILIKVRRTK PFIIFGISCW IVSFGLLVHY RGDSGAHSGI

     451  IGSLCLLGFG AGSFTYVTQA SIQASAKTHA RMAVVTSLYL ATYNIGSAFG

     501  SSVSGAVWTN ILPKEISKRI SDPTLAAQAY GSPFTFITTY TWGTPERIAL

     551  VMSYRYVQKI LCIIGLVFCF PLLGCAFMLR NHKLTDSIAL EGNDHLESKN

     601  TFEIEEKEES FLKNKFFTHF TSSKDRKD*

Protein Sequence for MIT_Smik_c202_5644:

MIT_Smik_c202_5644  Length: 629  Mon Nov  7 15:13:15 2016  Type: P  Check: 6209  ..

       1  MDPATANHAL PEDFTEDVVP DILEKEVGAI VDVNPTLTTS SPAPSYIELI

      51  DPGVYNIEIY AEMYSRPLYR VALFFSLFLI AYAYGLDGNI RYTFQAYATS

     101  SYSQHSLLST VNCIKTVIAA VGQIFFARLS DIFGRFSIMI VSVIFYSVGT

     151  IIESQAVNIT RFAVGGCFYQ LGLTGIILIL EVIASDFSNL NWRLLALFIP

     201  ALPFIINTWI SGDVTSAIGT NWKWGIGMWA FILPLACIPL GICMLHMRYL

     251  ARKHAKDRLK PEFEALNKLK WKSFCIDIAF WKLDIIGMLL ITVFFGCVLV

     301  PFTLAGGLKE EWKSAHIIVP EVIGWVVVLP LYMLWEMKYS RHPLTPWDLI

     351  KDRGIFFALL IAFFINFNWY MQGDYMYTVL VVAVHESIKS ATRITSLYSF

     401  VSVIVGTILG FILIKVRRTK PFIIFGISCW IVSFGLLVHY RGDSGAHSGI

     451  IGSLCLLGFG AGSFTYVTQA SIQASAKTHA RMAVVTSLYL ATYNIGSAFG

     501  SSVSGAVWTN ILPKEISKRI SDPTLAAQAY SAPFTFITTY TWGTPERIAL

     551  VMSYRYVQKI LCIIGLVFCF PLLGCAFMLR NHELTDSIAL EGNDHLKSKD

     601  SFETEEKQES FLKSMIFTRF TRSEDKRN*

Protein Sequence for MIT_Spar_c356_5984:

MIT_Spar_c356_5984  Length: 629  Mon Nov  7 15:13:15 2016  Type: P  Check: 5035  ..

       1  MDPATANHTL TEEFTEVVVP EMLEKEAAAT VDVNPTLTTS SPAPSYIELI

      51  DPGVHNIEIY AEMYNHPVYR VALFFSLFLI AYAYGLDGNI RYTFQAYATS

     101  SYSQHSLLST VNCIKTVIAA VGQIFFARLS DIFGRFSIMI VSIIFYSMGT

     151  IIESQAVNIT RFAVGGCFYQ LGLTGIILIL EVIASDFSNL NWRLLALFIP

     201  ALPFIINTWI SGDVTSAIGT NWKWGIGMWA FILPLACIPL GLCMLHMRYL

     251  ARKHAKDRLK PEFEALNKLK WKSFCIDIAF WKLDIIGMLL ITVFFGCVLV

     301  PFTLAGGLKE EWRTAHIIVP EVIGWVVVLP LYMIWEMKYS RHPLTPWDLL

     351  QDRGIFFALL IAFFINFNWY MQGDYMYTVL VVAVHESIKS ATRITSLYSF

     401  VSVIVGTILG FILIKVRRTK PFIIFGISCW IVSFGLLVHY RGDSGAHSGI

     451  IGSLCLLGFG AGSFTYVTQA SIQASAKTHA RMAVVTSLYL ATYNIGSAFG

     501  SSVSGAVWTN ILPKEISKRI SDPTLAAQAY GSPFTFITTY TWGTPERIAL

     551  VMSYRYVQKI LCIIGLVFCF PLLGCAFMLR NHKLTDSIAL EGNDHLESRN

     601  SSETEEKEES FLKSKFFTQF TSSKGKEN*

Protein Sequence for MIT_Suva_c280_5966:

MIT_Suva_c280_5966  Length: 628  Mon Nov  7 15:13:15 2016  Type: P  Check: 5623  ..

       1  MDPATANRAL PEEFTEVVVP EILEKEVGTT TAAGPALTTS SPAPSYIELI

      51  DPGVRNIEIY AEQYSRPLYR AGLFFSIFLI AYAYGLDGGI RYTFQAYATS

     101  SYSQHSLLST VNCIKTVIAA VGQIFFARLS DIFGRFSILV ISVIFYSVGT

     151  IIESQAVTIT RFAVGGCFYQ LGLTGVILIL EVIASDFSNL NWRLLALFVP

     201  ALPFIVNTWI SGDVTSAIGT NWKWGIGMWA FILPLACIPL GLCMLHMRYL

     251  ARKHAKDKLR PEFETLNNLD WKSFSIDIVF WKLDLIGLLL VTAFFGCVLV

     301  PFTLAGGLKE EWKAAHIIVP EVIGWVVALP LYMVWEVKYS RHPLTPWDLI

     351  KDRGVLFALF IAFFINFNWY MQGDYMYTVL VVAVHESIKS ATRITALYSF

     401  VSVIVGTILG FILIKVRRTK PFILFGISCW IVSFGLLVHY RGDSGAHAGI

     451  IGSLCLLGFG AGSFTYVTQA SIQASAGTHA RMAIVTSLYL ATYNIGSAFG

     501  SSVSGAVWTN ILPKEISKRI SDPTLAAEAY GSPFTFITTY TWGTPERIAL

     551  VMSYRYVQKI LCIIGLVFCF PLLGCACMLR NHKLTDSIAL EGNDHLESKN

     601  DNEIVEKEET SLRTRFLAQF TSKEKKN*

Protein Sequence for WashU_Sbay_Contig676.52:

WashU_Sbay_Contig676.52  Length: 628  Mon Nov  7 15:13:15 2016  Type: P  Check: 5623  ..

       1  MDPATANRAL PEEFTEVVVP EILEKEVGTT TAAGPALTTS SPAPSYIELI

      51  DPGVRNIEIY AEQYSRPLYR AGLFFSIFLI AYAYGLDGGI RYTFQAYATS

     101  SYSQHSLLST VNCIKTVIAA VGQIFFARLS DIFGRFSILV ISVIFYSVGT

     151  IIESQAVTIT RFAVGGCFYQ LGLTGVILIL EVIASDFSNL NWRLLALFVP

     201  ALPFIVNTWI SGDVTSAIGT NWKWGIGMWA FILPLACIPL GLCMLHMRYL

     251  ARKHAKDKLR PEFETLNNLD WKSFSIDIVF WKLDLIGLLL VTAFFGCVLV

     301  PFTLAGGLKE EWKAAHIIVP EVIGWVVALP LYMVWEVKYS RHPLTPWDLI

     351  KDRGVLFALF IAFFINFNWY MQGDYMYTVL VVAVHESIKS ATRITALYSF

     401  VSVIVGTILG FILIKVRRTK PFILFGISCW IVSFGLLVHY RGDSGAHAGI

     451  IGSLCLLGFG AGSFTYVTQA SIQASAGTHA RMAIVTSLYL ATYNIGSAFG

     501  SSVSGAVWTN ILPKEISKRI SDPTLAAEAY GSPFTFITTY TWGTPERIAL

     551  VMSYRYVQKI LCIIGLVFCF PLLGCACMLR NHKLTDSIAL EGNDHLESKN

     601  DNEIVEKEET SLRTRFLAQF TSKEKKN*

Protein Sequence for WashU_Scas_Contig514.3:

WashU_Scas_Contig514.3  Length: 635  Mon Nov  7 15:13:15 2016  Type: P  Check: 3637  ..

       1  MSSVSTTDQD IHNLSTQAHT QDDSIKKETV SATINSVSSL SEESVKDAGV

      51  NNIEIYAEQY QNPFLRAMLF FSLFLVAYAY GLDGNIRYTF QALATSSYSE

     101  HSLLSTVNCI KTVIAAAGQI WFARASDIFG RLTILGVSII FYIIGTVIES

     151  QATNVARFTA GGCFYQLGYT GAMLIIEIIA TDFSNLNWRL LALFIPALPF

     201  IINTWISGDV TAAVNGNWKW GIGMWAFIFP LACIPLACCM LHMRYLAHKN

     251  AKDRLMPSFT IPKDVSRKEY FIDVFFWRLD MIGLLLIVCF FGCVLIPFTL

     301  AGGMKEQWRT AHIIVPEVIG WCVALPLYIL WEIKFSRHPL TPWELLKDRG

     351  VYSALIIAFL INFCWYMQGD YMYTVLIVAV HESVKAATRI TSLYSFVSVI

     401  TGTILGLFLV KLRRTKPFIL FGICGWFISF GLLIHYRGDS GAHAGIIGSL

     451  CLLGFCAGFF TYTTQTSIQA TTRSHAKMAV ITALYLACYN IGSSFGAAVS

     501  GGVWTNVLPD RISRGISNQT LAAEAYGSPF TFIITYTWET AERQAVVKAY

     551  RETQKILCII GLVFCVPLLM AALMLRDHKL EDVVALDQMS EKVVEDDDPI

     601  FAFLKKCIPF YNKKNGETST VTTSTDGNDV VEMV*