Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YDR481C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_PHO8/YDR481C   1   MMTHTLPSEQTRLVPGSDSSSRPKKRRISKRSKIIVSTVVCIGLLLVLVQ   50
MIT_Smik_c650_5340   1   MMTHTLAGEQTRLVPGSNSTSRSRERRISKRSKIIVSTVVFIGLLLVLVQ   50
MIT_Spar_c350_5480   1   MMTHTLPGEQTRLVPGSNSNSRPKKKRISKRSKIIISTVVFIGLLLVLVQ   50
MIT_Suva_c467_5661   1   MMTHALAGEQTRLVPGSTSRSRPNRRRLSKRSNVIIATVIFIGLLLVLVQ   50
WashU_Sbay_Contig631.39   1   MMTHALAGEQTRLVPGSTSRSRPNRRRLSKRSNVIIATVIFIGLLLVLVQ   50
WashU_Scas_Contig721.52   1   --------MALKMSSNSYEHASLLQHPKRKQKRILPTTIVLIILTFIIYR   42
WashU_Skud_Contig1730.3   1   MMTHTLPGEQTRLVPGSNSNSRPKKRRISKRSKIIVSTVVLIGLLLVLLQ   50
WashU_Smik_Contig2047.3   1   MMTHTLAGEQTRLVPGSNSTSRSRERRISKRSKIIVSTVVFIGLLLVLVQ   50
Symbols






:: ..* . : .: *:..:: :*:: * * ::: :



SGD_Scer_PHO8/YDR481C   51   LAFPSSFALRSASHKKKNVIFFVTDGMGPASLSMARSFNQHVNDLPIDDI   100
MIT_Smik_c650_5340   51   LAFPSSFVLRSSSHKKKNVIFFVTDGMGPASLSMARSFNQHIHDLQINDI   100
MIT_Spar_c350_5480   51   LAFPSSFALRSASHKRKNVIFFVTDGMGPASLSMARSFNQHVHDLPIDDI   100
MIT_Suva_c467_5661   51   LAFPSTFALRSTPDKKKNVIFFVTDGMGPASLSMARSFNQHIHDLPIDDI   100
WashU_Sbay_Contig631.39   51   LAFPSTFALRSTPDKKKNVIFFVTDGMGPASLSMARSFNQHIHDLPIDDI   100
WashU_Scas_Contig721.52   43   LTSNNNEPFFEAKSKKKNVIFFVSDGMGPASLSLTRSFRQYSQNLTIDDI   92
WashU_Skud_Contig1730.3   51   LVFPNTIVLRSASNKKKNVIFFVTDGMGPASLSMARSFKQHILDLAIDDI   100
WashU_Smik_Contig2047.3   51   LAFPSSFVLRSSSHKKKNVIFFVTDGMGPASLSMARSFNQHIHDLQINDI   100
Symbols






*. .. : .: *:*******:*********::***.*: :* *:**



SGD_Scer_PHO8/YDR481C   101   LTLDEHFIGSSRTRSSDSLVTDSAAGATAFACALKSYNGAIGVDPHHRPC   150
MIT_Smik_c650_5340   101   LTLDQHFIGSSRTRSSDSLVTDSAAGATAFACALKSYNGAIGVDPDHKPC   150
MIT_Spar_c350_5480   101   LILDQHFIGSSRTRSSDSLVTDSAAGATAFACALKSYNGAIGVDPHHKPC   150
MIT_Suva_c467_5661   101   LRLDQHFIGSSRTRSSDSLVTDSAAGATAFACALKSYNGAIGVDPHQNPC   150
WashU_Sbay_Contig631.39   101   LRLDQHFIGSSRTRSSDSLVTDSAAGATAFACALKSYNGAIGVDPHQNPC   150
WashU_Scas_Contig721.52   93   LTLDKHLIGTSRTRSSDSLITDSAAGATAFSCALKTYNSACGIDSNKNPC   142
WashU_Skud_Contig1730.3   101   LTLDQHFIGSSRTRSSNSLVTDSAAGATAFACALKSYNGAIGVDTHHRPC   150
WashU_Smik_Contig2047.3   101   LTLDQHFIGSSRTRSSDSLVTDSAAGATAFACALKSYNGAIGVDPDHKPC   150
Symbols






* **:*:**:******:**:**********:****:**.* *:*..:.**



SGD_Scer_PHO8/YDR481C   151   GTVLEAAKLAGYLTGLVVTTRITDATPASFSSHVDYRWQEDLIATHQLGE   200
MIT_Smik_c650_5340   151   GTVLEAAKLAGYLTGLVVTTRITDATPASFSSHVDYRWQEDLIATHQLGG   200
MIT_Spar_c350_5480   151   GTVLEAAKLAGYLTGLVVTTRITDATPASFSSHVDYRWQEDLIATHQLGE   200
MIT_Suva_c467_5661   151   GTVLEAAKLAGYFTGLVVTTRITDATPASFSSHADYRWQEDLIATHQLGE   200
WashU_Sbay_Contig631.39   151   GTVLEAAKLAGYFTGLVVTTRITDATPASFSSHADYRWQEDLIATHQLGE   200
WashU_Scas_Contig721.52   143   GTLLEAAHLDGLLTGMVVTTRITDATPAAFSSHVDYRFQEDLIAEHQLGY   192
WashU_Skud_Contig1730.3   151   GTVLEAAKLAGYLTGLVVTTRITDATPASFSSHVDYRWQEDLIATHQLGE   200
WashU_Smik_Contig2047.3   151   GTVLEAAKLAGYLTGLVVTTRITDATPASFSSHVDYRWQEDLIATHQLGG   200
Symbols






**:****:* * :**:************:****.***:****** ****



SGD_Scer_PHO8/YDR481C   201   YPLGRVVDLLMGGGRSHFYPQGEKASPYGHHGARKDGRDLIDEAQSNGWQ   250
MIT_Smik_c650_5340   201   YPLGRVVDLLMGGGRSHFYPQGEEASPYGHHGSRKDGRDLIDEAQSNGWQ   250
MIT_Spar_c350_5480   201   YPLGRAVDLLMGGGRSHFYPQGEKASPYGHHGSRKDGRDLIDEAKSNGWQ   250
MIT_Suva_c467_5661   201   YPLGRMVDLLMGGGRTHFYPHGSDASPYGHQGSRKDGRDLIDEAQSNGWQ   250
WashU_Sbay_Contig631.39   201   YPLGRMVDLLMGGGRTHFYPHGSDASPYGHQGSRKDGRDLIDEAQSNGWQ   250
WashU_Scas_Contig721.52   193   YPLGRSVDLIIGGGRTHFYSTAP-------GGSRKDGRNLIEEAIDDGWQ   235
WashU_Skud_Contig1730.3   201   YPLGRVVDLLMGGGRSHFYPYGEEASPYGRHGSRKDGRDLIDEAKSNGWQ   250
WashU_Smik_Contig2047.3   201   YPLGRVVDLLMGGGRSHFYPQGEEASPYGHHGSRKDGRDLIDEAQSNGWQ   250
Symbols






***** ***::****:***. . *:*****:**:** .:***



SGD_Scer_PHO8/YDR481C   251   YVGDRKNFDSLLKSHGENVTLPFLGLFADNDIPFEIDRDEKEYPSLKEQV   300
MIT_Smik_c650_5340   251   YVGDRESFDSLLNSHGENVTLPLLGLFADNDIPFEIDRDEKEYPSLKEQV   300
MIT_Spar_c350_5480   251   YVGDRKSFDFLLKSHGDNVTLPLLGLFADNDIPFEIDRDEKEYPSLKEQV   300
MIT_Suva_c467_5661   251   YVGDRKSFDSLLNSHGDNVSLPLLGLFADNDIPFEIDRDEKEYPSLKEQV   300
WashU_Sbay_Contig631.39   251   YVGDRKSFDSLLNSHGDNVSLPLLGLFADNDIPFEIDRDEKEYPSLKEQV   300
WashU_Scas_Contig721.52   236   YVGNREQFDQLQMG--KNVSLPLLALLADGDIPFDLDRDDTKYPSLEEQT   283
WashU_Skud_Contig1730.3   251   YVGDRKSFDSLLDNNGDNITLPLLGLFADNDIPFEIDRDEKEYPSLKDQV   300
WashU_Smik_Contig2047.3   251   YVGDRESFDSLLNSHGENVTLPLLGLFADNDIPFEIDRDEKEYPSLKEQV   300
Symbols






***:*:.** * . .*::**:*.*:**.****::***:.:****::*.



SGD_Scer_PHO8/YDR481C   301   KVALGALEKASNEDKDSNGFFLMVEGSRIDHAGHQNDPASQVREVLAFDE   350
MIT_Smik_c650_5340   301   TVALNALERASSEDKDSNGFFLMVEGSRIDHAGHQNDPASQVREVLAFDE   350
MIT_Spar_c350_5480   301   IVALNALEKASNEDKDSNGFFLMVEGSRIDHAGHQNDPASQVREVLAFDE   350
MIT_Suva_c467_5661   301   SVALKALEKASNEDEDSNGFFLMVEGSRIDHAGHQNDPASQVREVLAFDE   350
WashU_Sbay_Contig631.39   301   SVALKALEKASNEDEDSNGFFLMVEGSRIDHAGHQNDPASQVREVLAFDE   350
WashU_Scas_Contig721.52   284   LTALKALSEATEDSDK--GFFLLVEGSRIDHAGHQNDPSAQVREVLAFDK   331
WashU_Skud_Contig1730.3   301   TVALNALEKASNEDKDSNGFFLMVEGSRIDHAGHQNDPASQVREVLAFDE   350
WashU_Smik_Contig2047.3   301   TVALNALERASSEDKDSNGFFLMVEGSRIDHAGHQNDPASQVREVLAFDE   350
Symbols






.** **..*:.:... ****:***************::*********:



SGD_Scer_PHO8/YDR481C   351   AFQYVLEFAENSDTETVLVSTSDHETGGLVTSRQVTASYPQYVWYPQVLA   400
MIT_Smik_c650_5340   351   AFQYVLEFAENSDTETVLVSTSDHETGGLVTSRQVTVSYPEYVWYPQVLA   400
MIT_Spar_c350_5480   351   AFQYVLEFAEDSNTETVLVSTSDHETGGLVTSRQVTASYPQYVWYPQVLA   400
MIT_Suva_c467_5661   351   AFQYVLEFAKNSDTETVLVSTSDHETGGLVTSRQVTTSYPDYVWYPQVLA   400
WashU_Sbay_Contig631.39   351   AFQYVLEFAKNSDTETVLVSTSDHETGGLVTSRQVTTSYPDYVWYPQVLA   400
WashU_Scas_Contig721.52   332   AFNSALEFINDLDTETIILSTSDHETGGLVTARQVTKEYPDYVWYPSYLN   381
WashU_Skud_Contig1730.3   351   AFQYVLEFAESSDTETVLVSTSDHETGGLAVSRQVTVGYPDYVWYPQVLA   400
WashU_Smik_Contig2047.3   351   AFQYVLEFAENSDTETVLVSTSDHETGGLVTSRQVTVSYPEYVWYPQVLA   400
Symbols






**: .*** :. :***:::**********..:**** **:*****. *



SGD_Scer_PHO8/YDR481C   401   NATHSGEFLKRKLVDFVHEHKGASSKIENFIKHEILEKDLGIYDYTDSDL   450
MIT_Smik_c650_5340   401   NATHSGEFLKTKLVGFVHEHEGSISKIEDFIKYEILEKDLGIYDYTDNDV   450
MIT_Spar_c350_5480   401   NATHSGEFLKRKLVDFVHEHKGATSKIENFIKHEILEKDLGIYDYADSDL   450
MIT_Suva_c467_5661   401   NATHSGEFLKKKLVDFVHDLG-ATGKLENFIKHEILERDLGIFDYTEDDV   449
WashU_Sbay_Contig631.39   401   NATHSGEFLKKKLVDFVHDLG-ATGKLENFIKHEILERDLGIFDYTEDDV   449
WashU_Scas_Contig721.52   382   NAKHSGEFLKSTVLSYNAEEHTMNEKED-FVRYEILENFLGIHDYQEEDV   430
WashU_Skud_Contig1730.3   401   NATHSGEFLKRKLVDFVHVHKGATSKIENFIKYEVLERDLGIFDYTDDDV   450
WashU_Smik_Contig2047.3   401   NATHSGEFLKTKLVGFVHEHEGSISKIEDFIKYEILEKDLGIYDYTDNDV   450
Symbols






**.******* .::.: * : *:::*:**. ***.** :.*:



SGD_Scer_PHO8/YDR481C   451   ETLIHLDDNANAIQDKLNDMVSFRAQIGWTTHGHSAVDVNIYAYANKKAT   500
MIT_Smik_c650_5340   451   ETLIHLGDNANAVQDKLNDMVSFRAQIGWTTHGHSAVDVNIYAYTNKKTT   500
MIT_Spar_c350_5480   451   ETLIHLGDDANAIQDKLNDMVSFRAQIGWTTHGHSAVDVNIYAYANKKFT   500
MIT_Suva_c467_5661   450   NTLIHLGDNANAIQEKLNDMVSFRARIGWTTHGHSAVDVNIYAYTNRKTT   499
WashU_Sbay_Contig631.39   450   NTLIHLGDNANAIQEKLNDMVSFRARIGWTTHGHSAVDVNIYAYTNRKTT   499
WashU_Scas_Contig721.52   431   KELATMTN-PIDIQRKINYMISYRAQIGWTTEGHSAVDVYIYGYSNRKTS   479
WashU_Skud_Contig1730.3   451   KTLIHLGDNMNAIQDKLNDMVSFRAQIGWTTHGHSAVDVNIYAYTNKKAT   500
WashU_Smik_Contig2047.3   451   ETLIHLGDNANAVQDKLNDMVSFRAQIGWTTHGHSAVDVNIYAYTNKKTT   500
Symbols






: * : : :* *:* *:*:**:*****.******* **.*:*:* :



SGD_Scer_PHO8/YDR481C   501   WSYVLNNLQGNHENTEVGQFLENFLELNLNEVTDLIRDTKHTSDFDATEI   550
MIT_Smik_c650_5340   501   WSYILESLQGNHENIEIGHFLENYLELNLSKVTDLISDTKHSSDFDSAEV   550
MIT_Spar_c350_5480   501   WSYVLNNLQGNHENTEIGQFLENYLELNLGEVTDLIRDTKHASDFGATEI   550
MIT_Suva_c467_5661   500   WSYLLEKLQGNHENTEIGQFLADYLELNLSKVTDLISKTKHSLDFSATEI   549
WashU_Sbay_Contig631.39   500   WSYLLEKLQGNHENTEIGQFLADYLELNLSKVTDLISKTKHSLDFSATEI   549
WashU_Scas_Contig721.52   480   WLQILENLQGNHENIEIGQFIKNYLKLDLDKVTKLVKDTDHSPKLSTKEV   529
WashU_Skud_Contig1730.3   501   WSYLLESLQGNHENTEVGQFLENYLELNLSKITDLISDTKHSSDFDAAEI   550
WashU_Smik_Contig2047.3   501   WSYILESLQGNHENIEIGHFLENYLELNLSKVTDLISDTKHSSDFDSAEV   550
Symbols






* :*:.******* *:*:*: ::*:*:*.::*.*: .*.*: .:.: *:



SGD_Scer_PHO8/YDR481C   551   ASEVQHYDEYYHELTN-   566
MIT_Smik_c650_5340   551   ANEVPHYDEYYHELSN-   566
MIT_Spar_c350_5480   551   ASEVSHYDEYYHELSK-   566
MIT_Suva_c467_5661   550   ANEVPHYDEYFHELST-   565
WashU_Sbay_Contig631.39   550   ANEVPHYDEYFHELST-   565
WashU_Scas_Contig721.52   530   E-ELPLFDEYMHQLKNN   545
WashU_Skud_Contig1730.3   551   ASEVPHYDEYYHELSH-   566
WashU_Smik_Contig2047.3   551   ANEVPHYDEYYHELSN-   566
Symbols






*: :*** *:*.



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_PHO8/YDR481C:

SGD_Scer_PHO8/YDR481C  Length: 567  Mon Nov  7 15:10:28 2016  Type: P  Check: 179  ..

       1  MMTHTLPSEQ TRLVPGSDSS SRPKKRRISK RSKIIVSTVV CIGLLLVLVQ

      51  LAFPSSFALR SASHKKKNVI FFVTDGMGPA SLSMARSFNQ HVNDLPIDDI

     101  LTLDEHFIGS SRTRSSDSLV TDSAAGATAF ACALKSYNGA IGVDPHHRPC

     151  GTVLEAAKLA GYLTGLVVTT RITDATPASF SSHVDYRWQE DLIATHQLGE

     201  YPLGRVVDLL MGGGRSHFYP QGEKASPYGH HGARKDGRDL IDEAQSNGWQ

     251  YVGDRKNFDS LLKSHGENVT LPFLGLFADN DIPFEIDRDE KEYPSLKEQV

     301  KVALGALEKA SNEDKDSNGF FLMVEGSRID HAGHQNDPAS QVREVLAFDE

     351  AFQYVLEFAE NSDTETVLVS TSDHETGGLV TSRQVTASYP QYVWYPQVLA

     401  NATHSGEFLK RKLVDFVHEH KGASSKIENF IKHEILEKDL GIYDYTDSDL

     451  ETLIHLDDNA NAIQDKLNDM VSFRAQIGWT THGHSAVDVN IYAYANKKAT

     501  WSYVLNNLQG NHENTEVGQF LENFLELNLN EVTDLIRDTK HTSDFDATEI

     551  ASEVQHYDEY YHELTN*

Protein Sequence for MIT_Smik_c650_5340:

MIT_Smik_c650_5340  Length: 567  Mon Nov  7 15:10:28 2016  Type: P  Check: 3519  ..

       1  MMTHTLAGEQ TRLVPGSNST SRSRERRISK RSKIIVSTVV FIGLLLVLVQ

      51  LAFPSSFVLR SSSHKKKNVI FFVTDGMGPA SLSMARSFNQ HIHDLQINDI

     101  LTLDQHFIGS SRTRSSDSLV TDSAAGATAF ACALKSYNGA IGVDPDHKPC

     151  GTVLEAAKLA GYLTGLVVTT RITDATPASF SSHVDYRWQE DLIATHQLGG

     201  YPLGRVVDLL MGGGRSHFYP QGEEASPYGH HGSRKDGRDL IDEAQSNGWQ

     251  YVGDRESFDS LLNSHGENVT LPLLGLFADN DIPFEIDRDE KEYPSLKEQV

     301  TVALNALERA SSEDKDSNGF FLMVEGSRID HAGHQNDPAS QVREVLAFDE

     351  AFQYVLEFAE NSDTETVLVS TSDHETGGLV TSRQVTVSYP EYVWYPQVLA

     401  NATHSGEFLK TKLVGFVHEH EGSISKIEDF IKYEILEKDL GIYDYTDNDV

     451  ETLIHLGDNA NAVQDKLNDM VSFRAQIGWT THGHSAVDVN IYAYTNKKTT

     501  WSYILESLQG NHENIEIGHF LENYLELNLS KVTDLISDTK HSSDFDSAEV

     551  ANEVPHYDEY YHELSN*

Protein Sequence for MIT_Spar_c350_5480:

MIT_Spar_c350_5480  Length: 567  Mon Nov  7 15:10:28 2016  Type: P  Check: 7446  ..

       1  MMTHTLPGEQ TRLVPGSNSN SRPKKKRISK RSKIIISTVV FIGLLLVLVQ

      51  LAFPSSFALR SASHKRKNVI FFVTDGMGPA SLSMARSFNQ HVHDLPIDDI

     101  LILDQHFIGS SRTRSSDSLV TDSAAGATAF ACALKSYNGA IGVDPHHKPC

     151  GTVLEAAKLA GYLTGLVVTT RITDATPASF SSHVDYRWQE DLIATHQLGE

     201  YPLGRAVDLL MGGGRSHFYP QGEKASPYGH HGSRKDGRDL IDEAKSNGWQ

     251  YVGDRKSFDF LLKSHGDNVT LPLLGLFADN DIPFEIDRDE KEYPSLKEQV

     301  IVALNALEKA SNEDKDSNGF FLMVEGSRID HAGHQNDPAS QVREVLAFDE

     351  AFQYVLEFAE DSNTETVLVS TSDHETGGLV TSRQVTASYP QYVWYPQVLA

     401  NATHSGEFLK RKLVDFVHEH KGATSKIENF IKHEILEKDL GIYDYADSDL

     451  ETLIHLGDDA NAIQDKLNDM VSFRAQIGWT THGHSAVDVN IYAYANKKFT

     501  WSYVLNNLQG NHENTEIGQF LENYLELNLG EVTDLIRDTK HASDFGATEI

     551  ASEVSHYDEY YHELSK*

Protein Sequence for MIT_Suva_c467_5661:

MIT_Suva_c467_5661  Length: 566  Mon Nov  7 15:10:28 2016  Type: P  Check: 5444  ..

       1  MMTHALAGEQ TRLVPGSTSR SRPNRRRLSK RSNVIIATVI FIGLLLVLVQ

      51  LAFPSTFALR STPDKKKNVI FFVTDGMGPA SLSMARSFNQ HIHDLPIDDI

     101  LRLDQHFIGS SRTRSSDSLV TDSAAGATAF ACALKSYNGA IGVDPHQNPC

     151  GTVLEAAKLA GYFTGLVVTT RITDATPASF SSHADYRWQE DLIATHQLGE

     201  YPLGRMVDLL MGGGRTHFYP HGSDASPYGH QGSRKDGRDL IDEAQSNGWQ

     251  YVGDRKSFDS LLNSHGDNVS LPLLGLFADN DIPFEIDRDE KEYPSLKEQV

     301  SVALKALEKA SNEDEDSNGF FLMVEGSRID HAGHQNDPAS QVREVLAFDE

     351  AFQYVLEFAK NSDTETVLVS TSDHETGGLV TSRQVTTSYP DYVWYPQVLA

     401  NATHSGEFLK KKLVDFVHDL GATGKLENFI KHEILERDLG IFDYTEDDVN

     451  TLIHLGDNAN AIQEKLNDMV SFRARIGWTT HGHSAVDVNI YAYTNRKTTW

     501  SYLLEKLQGN HENTEIGQFL ADYLELNLSK VTDLISKTKH SLDFSATEIA

     551  NEVPHYDEYF HELST*

Protein Sequence for WashU_Sbay_Contig631.39:

WashU_Sbay_Contig631.39  Length: 566  Mon Nov  7 15:10:28 2016  Type: P  Check: 5444  ..

       1  MMTHALAGEQ TRLVPGSTSR SRPNRRRLSK RSNVIIATVI FIGLLLVLVQ

      51  LAFPSTFALR STPDKKKNVI FFVTDGMGPA SLSMARSFNQ HIHDLPIDDI

     101  LRLDQHFIGS SRTRSSDSLV TDSAAGATAF ACALKSYNGA IGVDPHQNPC

     151  GTVLEAAKLA GYFTGLVVTT RITDATPASF SSHADYRWQE DLIATHQLGE

     201  YPLGRMVDLL MGGGRTHFYP HGSDASPYGH QGSRKDGRDL IDEAQSNGWQ

     251  YVGDRKSFDS LLNSHGDNVS LPLLGLFADN DIPFEIDRDE KEYPSLKEQV

     301  SVALKALEKA SNEDEDSNGF FLMVEGSRID HAGHQNDPAS QVREVLAFDE

     351  AFQYVLEFAK NSDTETVLVS TSDHETGGLV TSRQVTTSYP DYVWYPQVLA

     401  NATHSGEFLK KKLVDFVHDL GATGKLENFI KHEILERDLG IFDYTEDDVN

     451  TLIHLGDNAN AIQEKLNDMV SFRARIGWTT HGHSAVDVNI YAYTNRKTTW

     501  SYLLEKLQGN HENTEIGQFL ADYLELNLSK VTDLISKTKH SLDFSATEIA

     551  NEVPHYDEYF HELST*

Protein Sequence for WashU_Scas_Contig721.52:

WashU_Scas_Contig721.52  Length: 546  Mon Nov  7 15:10:28 2016  Type: P  Check: 6060  ..

       1  MALKMSSNSY EHASLLQHPK RKQKRILPTT IVLIILTFII YRLTSNNNEP

      51  FFEAKSKKKN VIFFVSDGMG PASLSLTRSF RQYSQNLTID DILTLDKHLI

     101  GTSRTRSSDS LITDSAAGAT AFSCALKTYN SACGIDSNKN PCGTLLEAAH

     151  LDGLLTGMVV TTRITDATPA AFSSHVDYRF QEDLIAEHQL GYYPLGRSVD

     201  LIIGGGRTHF YSTAPGGSRK DGRNLIEEAI DDGWQYVGNR EQFDQLQMGK

     251  NVSLPLLALL ADGDIPFDLD RDDTKYPSLE EQTLTALKAL SEATEDSDKG

     301  FFLLVEGSRI DHAGHQNDPS AQVREVLAFD KAFNSALEFI NDLDTETIIL

     351  STSDHETGGL VTARQVTKEY PDYVWYPSYL NNAKHSGEFL KSTVLSYNAE

     401  EHTMNEKEDF VRYEILENFL GIHDYQEEDV KELATMTNPI DIQRKINYMI

     451  SYRAQIGWTT EGHSAVDVYI YGYSNRKTSW LQILENLQGN HENIEIGQFI

     501  KNYLKLDLDK VTKLVKDTDH SPKLSTKEVE ELPLFDEYMH QLKNN*


Protein Sequence for WashU_Skud_Contig1730.3:

WashU_Skud_Contig1730.3  Length: 567  Mon Nov  7 15:10:28 2016  Type: P  Check: 9928  ..

       1  MMTHTLPGEQ TRLVPGSNSN SRPKKRRISK RSKIIVSTVV LIGLLLVLLQ

      51  LVFPNTIVLR SASNKKKNVI FFVTDGMGPA SLSMARSFKQ HILDLAIDDI

     101  LTLDQHFIGS SRTRSSNSLV TDSAAGATAF ACALKSYNGA IGVDTHHRPC

     151  GTVLEAAKLA GYLTGLVVTT RITDATPASF SSHVDYRWQE DLIATHQLGE

     201  YPLGRVVDLL MGGGRSHFYP YGEEASPYGR HGSRKDGRDL IDEAKSNGWQ

     251  YVGDRKSFDS LLDNNGDNIT LPLLGLFADN DIPFEIDRDE KEYPSLKDQV

     301  TVALNALEKA SNEDKDSNGF FLMVEGSRID HAGHQNDPAS QVREVLAFDE

     351  AFQYVLEFAE SSDTETVLVS TSDHETGGLA VSRQVTVGYP DYVWYPQVLA

     401  NATHSGEFLK RKLVDFVHVH KGATSKIENF IKYEVLERDL GIFDYTDDDV

     451  KTLIHLGDNM NAIQDKLNDM VSFRAQIGWT THGHSAVDVN IYAYTNKKAT

     501  WSYLLESLQG NHENTEVGQF LENYLELNLS KITDLISDTK HSSDFDAAEI

     551  ASEVPHYDEY YHELSH*

Protein Sequence for WashU_Smik_Contig2047.3:

WashU_Smik_Contig2047.3  Length: 567  Mon Nov  7 15:10:28 2016  Type: P  Check: 3519  ..

       1  MMTHTLAGEQ TRLVPGSNST SRSRERRISK RSKIIVSTVV FIGLLLVLVQ

      51  LAFPSSFVLR SSSHKKKNVI FFVTDGMGPA SLSMARSFNQ HIHDLQINDI

     101  LTLDQHFIGS SRTRSSDSLV TDSAAGATAF ACALKSYNGA IGVDPDHKPC

     151  GTVLEAAKLA GYLTGLVVTT RITDATPASF SSHVDYRWQE DLIATHQLGG

     201  YPLGRVVDLL MGGGRSHFYP QGEEASPYGH HGSRKDGRDL IDEAQSNGWQ

     251  YVGDRESFDS LLNSHGENVT LPLLGLFADN DIPFEIDRDE KEYPSLKEQV

     301  TVALNALERA SSEDKDSNGF FLMVEGSRID HAGHQNDPAS QVREVLAFDE

     351  AFQYVLEFAE NSDTETVLVS TSDHETGGLV TSRQVTVSYP EYVWYPQVLA

     401  NATHSGEFLK TKLVGFVHEH EGSISKIEDF IKYEILEKDL GIYDYTDNDV

     451  ETLIHLGDNA NAVQDKLNDM VSFRAQIGWT THGHSAVDVN IYAYTNKKTT

     501  WSYILESLQG NHENIEIGHF LENYLELNLS KVTDLISDTK HSSDFDSAEV

     551  ANEVPHYDEY YHELSN*