Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YDR299W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_BFR2/YDR299W   1   -MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGES--DLSDYG   47
MIT_Smik_c379_4611   1   -MGKSLADQISDIAIKPVNKDFDIEDAENTSLFQHNEKIGES--DGSDYE   47
MIT_Spar_c108_4837   1   -MGKSLADQISDIAIKPINKDFDIEDEENTSLFQHNEKNGES--DLSDYE   47
WashU_Sbay_Contig630.1   1   -MGKSLADQISDIAIKPVIKDYDIEDEENTSVFQHDENGAES--DLSDNE   47
WashU_Scas_Contig588.15   1   MTKKLLADKIAKKINKVAVPDFDIEDDE-RAVFEHNENANSSNDDLSDLD   49
WashU_Skud_Contig2003.2   1   -MGKLLADQISDIAIKPVNEDFDIEDEENASLFQHNEKGGES--DFSDNE   47
WashU_Smik_Contig2775.3   1   -MGKSLADQISDIAIKPVNKDFDIEDAENTSLFQHNEKIGES--DGSDYE   47
Symbols






* ***:*:. * *:**** * ::*:*:*: .* * **



SGD_Scer_BFR2/YDR299W   48   NSNTEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSEN   97
MIT_Smik_c379_4611   48   DANTEQTRKAHYVEVEKSTLRAEKGLELNDPKYTGVKGSRQALYDELSDS   97
MIT_Spar_c108_4837   48   DANIEQTKKAHYFEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSNN   97
WashU_Sbay_Contig630.1   48   DINREQAKKSHYLEVEKSALRAEKGLELNDPKYTGVKGSRQALYDDSSNS   97
WashU_Scas_Contig588.15   50   DEKEEELKSAHYVDVGKSKLRANT-LEIKDEKYQGSKGSRKDLFDNDNEN   98
WashU_Skud_Contig2003.2   48   DVNTEQAKKSHYLEVEKSKLRAEKGLELNDSKYTGVKGSRQALYNEFS--   95
WashU_Smik_Contig2775.3   48   DANTEQTRKAHYVEVEKSTLRAEKGLELNDPKYTGVKGSRQALYDELSDS   97
Symbols






: : *: :.:**.:* ** ***:. **::* ** * ****: *::: .



SGD_Scer_BFR2/YDR299W   98   EDE-EEEEEEE------EEKEEDALSFRTDSEDEEVEIDEEESDADGGE-   139
MIT_Smik_c379_4611   98   AEDDNEDSQEEDEEGKDEEEEGDALSFRTDSEDEQAENEVEEADIDGGE-   146
MIT_Spar_c108_4837   98   EEEGEEEEEDE------EDEEEDALSFRTDSEDEQVENEEEESDADGDE-   140
WashU_Sbay_Contig630.1   98   EDMEDDENESGQDEQENDGEDDDALSFRTDSEDEQAEDEAEESDVDDDE-   146
WashU_Scas_Contig588.15   99   VSDSGSSDEANNNEDDVSDSD-DAISLKTDSEDELISESEEESGDSEAEE   147
WashU_Skud_Contig2003.2   96   -DDEEDENEKSQEEENNDGEDDDALSFRTDSDDEQAEDEEK-SDSDGDE-   142
WashU_Smik_Contig2775.3   98   AEDDNEDSQEEDEEGKDEEEEGDALSFRTDSEDEQAENEVEEADIDGGE-   146
Symbols






. ...: . .: **:*::***:** . . : :. . *



SGD_Scer_BFR2/YDR299W   140   -TEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQTKLFDN   188
MIT_Smik_c379_4611   147   -MEEAQQKRDALSKLVQQETKQAINKLSQSVQRDALKGYSILQQTKLFDN   195
MIT_Spar_c108_4837   141   -MEEAQQKRQALSKLVQQETKHAINKLSQSVQRDASKGYSILQQTKLFDN   189
WashU_Sbay_Contig630.1   147   -MEEAAQKRSALSKLVQQETKQAINKLSQSVQRDATKGYSILQQTKLFDN   195
WashU_Scas_Contig588.15   148   EDEDTELKRERLAKLVQQETKQVMNKLSQSIQRDAAKGYSIANQNRLFDN   197
WashU_Skud_Contig2003.2   143   -MEEAQQKRNALSKLVQQETKRAINKLSQSVQKDASKGYSILQQTKLFDN   191
WashU_Smik_Contig2775.3   147   -MEEAQQKRDALSKLVQQETKQAINKLSQSVQRDALKGYSILQQTKLFDN   195
Symbols






*:: ** *:**:*****:.:******:*:** ***** :*.:****



SGD_Scer_BFR2/YDR299W   189   IIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEKLFNNL   238
MIT_Smik_c379_4611   196   IIDLRIKLQKAVIAANKLPLTAESWKEAKMENSKETKHLLNENEILFNKL   245
MIT_Spar_c108_4837   190   IIDLRIKLQKAVIAANKLPLTAESWEEAKMDDSQETKRLLKENEKLFNNL   239
WashU_Sbay_Contig630.1   196   IIDLRIKLQKAVITANKLPLTSDSWKEAKMDGSKETKHLLKENEKLFNNL   245
WashU_Scas_Contig588.15   198   IIDMRIKLQKAVTNANKLPITKESWNTYTVE-SKETTKLLNKSSELVNRV   246
WashU_Skud_Contig2003.2   192   IIDLRIKLQKAVIAANRLPLTTESWKEARMDNSRETKHLLKENEKLFNKL   241
WashU_Smik_Contig2775.3   196   IIDLRIKLQKAVIAANKLPLTAESWKEAKMENSKETKHLLNENEILFNKL   245
Symbols






***:******** **:**:* :**: :: *.**.:**::.. *.*.:



SGD_Scer_BFR2/YDR299W   239   FNRLINFRIKFQLGDHITQNEEVAK--HKLSKKRSLKELYQETNSLDSEL   286
MIT_Smik_c379_4611   246   FNQLINFRIKFQIDDHITQREETAK--HKISKKRSFKELYKETDSLDSEL   293
MIT_Spar_c108_4837   240   FNQLINFRIKFLLGDHITRSEETAK--HKISKKRSVKELHKETDSLDLEL   287
WashU_Sbay_Contig630.1   246   FNQLVNFRIKFQLGDHITQSDESKK--HKLSKKRSVKELYKETDSLDLEL   293
WashU_Scas_Contig588.15   247   LGQLINFRKDFQRGDNINQDIDSNDETSLHDKKRSFDDLNKDTDNLDEHL   296
WashU_Skud_Contig2003.2   242   FNQLINFRIKFQIGDHIAQSEEKAK--HKISNKRSVKELYKETDTLDSEL   289
WashU_Smik_Contig2775.3   246   FNQLINFRIKFQIDDHITQREETAK--HKISKKRSFKELYKETDSLDSEL   293
Symbols






:.:*:*** .* .*:* : : . .:***..:* ::*:.** .*



SGD_Scer_BFR2/YDR299W   287   KEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSDMSRL   336
MIT_Smik_c379_4611   294   KDYRNAVLNKWSTKVSSASGNSALSSNKFKAINLPADMQVENQLSDMSRL   343
MIT_Spar_c108_4837   288   KEYRSAVLNKWSTKVSSASGNSALSSNKFKAINLPADVQVENQLSDMSRL   337
WashU_Sbay_Contig630.1   294   KEYRNAVLNKWSTKVSSASGNSALSSSKFKAINQPADVQVENQLSDMSRL   343
WashU_Scas_Contig588.15   297   TKYRRAVLHKWSSKVTATSGNSALSSTKFKAINQPTDKQVENQLADLTRL   346
WashU_Skud_Contig2003.2   290   KEYRNAVLNKWSTKVSSASGNSALSSNKFKAINLSADVQVENQLSDMSRL   339
WashU_Smik_Contig2775.3   294   KDYRNAVLNKWSTKVSSASGNSALSSNKFKAINLPADMQVKNQLSDMSRL   343
Symbols






..** ***:***:**:::***:****.****** .:* **:***:*::**



SGD_Scer_BFR2/YDR299W   337   MKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVD---DNENSDDGL   383
MIT_Smik_c379_4611   344   MKRTKLNRRNITPLYFQKDCAAGRLSELISSTVDNGVD---DNENSDDGL   390
MIT_Spar_c108_4837   338   MKRTKLNRRNITPLYFQNDCANGRLPELTSPVVEDGVD---DNENSDDGL   384
WashU_Sbay_Contig630.1   344   MKRTKLNRRNITPMYFQKDWANGKLPELASQNVEDGDD---NNNNSDDGL   390
WashU_Scas_Contig588.15   347   RKRTYLNRRNLLPLGFQDDLKEKRLSYFQADADKAIDG----EEEEDINQ   392
WashU_Skud_Contig2003.2   340   MKRTKLNRRNIAPLYFQKDWASGKLPELASPNAKEEEEEDIDDNLLDDGL   389
WashU_Smik_Contig2775.3   344   MKRTKLNRRNITPLYFQKDCAAGRLSELISSTVDNGVD---DNENSDDGL   390
Symbols






*** *****: *: **.* :*. : : . :: * .



SGD_Scer_BFR2/YDR299W   384   DIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNSE   433
MIT_Smik_c379_4611   391   DIPKNYDPRRKDNSAIDIAENPYVFDDEDFYRVLLNDLIDKKISNAHNSE   440
MIT_Spar_c108_4837   385   DIPKNYDPRRKDNNAIDIAENPYVFDDEDFYRVLLNDLIDKKISNAHNSE   434
WashU_Sbay_Contig630.1   391   DIPKNYDPRRKDNNSVDTSENPYVFDDEDFYRVLLNDLIDKKISNAHNSE   440
WashU_Scas_Contig588.15   393   DIPKNYDPRRKDNNAIDTTENPYIFDDEDFYRVLLSDVVDKKTSNVQYGS   442
WashU_Skud_Contig2003.2   390   DIPKNYDPRRKDNNAIDTIENPYVFDDEDFYRVLLNDLIDKKISNAHNSE   439
WashU_Smik_Contig2775.3   391   DIPKNYDPRRKDNSAIDIAENPYVFDDEDFYRVLLNDLIDKKISNAHNSE   440
Symbols






*************.::* ****:***********.*::*** **.: ..



SGD_Scer_BFR2/YDR299W   434   SAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSGY   483
MIT_Smik_c379_4611   441   SAAITITSANSRSNNKLKKNIDTKASKGRKLNYSIQDPIANYEAPITSGY   490
MIT_Spar_c108_4837   435   SAAITITSANSRSSNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSGY   484
WashU_Sbay_Contig630.1   441   SAAITITSANSRSNNKLKKNVDTKASKGRKLNYSVQDPIANYEAPISSGY   490
WashU_Scas_Contig588.15   443   TENPTVTIS-SRSNNKLKKNIDTKASKGRKLNYSVQDPIANFEAPINSGY   491
WashU_Skud_Contig2003.2   440   SAAITITSAGSRSNNKLKKNIDTKASKGRKLNYSIQDPIANYEASIISGY   489
WashU_Smik_Contig2775.3   441   SAAITITSANSRSNNKLKKNIDTKASKGRKLNYSIQDPIANYEAPITSGY   490
Symbols






: *:* : :**.******:*************:******:**.* ***



SGD_Scer_BFR2/YDR299W   484   KWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQIF   533
MIT_Smik_c379_4611   491   KWSDDQIDEFFAGLLGQRVNFNENENEEQYAGEENDEESEAVKNDDIQIF   540
MIT_Spar_c108_4837   485   KWSDDQIDEFFAGLLGQRVNFNENDDGEQNVGEENDEELEAVKNDDIQIF   534
WashU_Sbay_Contig630.1   491   KWSDDQIDEFFAGLMGQRVNFNEDEEEDQHVGEDNDAESEAVKNDDIQIF   540
WashU_Scas_Contig588.15   492   KWNDEQIDEFFAGLLGQRINFNEDENEDDNNSGDDKEELEAIKNDDIQIF   541
WashU_Skud_Contig2003.2   490   KWSDDQIDEFFAGLLGQRVNFNENEDEHQHAGEDDNGDLEAVKNDDIQIF   539
WashU_Smik_Contig2775.3   491   KWSDDQIDEFFAGLLGQRVNFNENENEEQYAGEENDEESEAVKNDDIQIF   540
Symbols






**.*:*********:***:****::: .: ::. : **:********



SGD_Scer_BFR2/YDR299W   534   G   534
MIT_Smik_c379_4611   541   G   541
MIT_Spar_c108_4837   535   G   535
WashU_Sbay_Contig630.1   541   G   541
WashU_Scas_Contig588.15   542   G   542
WashU_Skud_Contig2003.2   540   G   540
WashU_Smik_Contig2775.3   541   G   541
Symbols






*



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_BFR2/YDR299W:

SGD_Scer_BFR2/YDR299W  Length: 535  Mon Nov  7 15:06:22 2016  Type: P  Check: 9975  ..

       1  MEKSLADQIS DIAIKPVNKD FDIEDEENAS LFQHNEKNGE SDLSDYGNSN

      51  TEETKKAHYL EVEKSKLRAE KGLELNDPKY TGVKGSRQAL YEEVSENEDE

     101  EEEEEEEEEK EEDALSFRTD SEDEEVEIDE EESDADGGET EEAQQKRHAL

     151  SKLIQQETKQ AINKLSQSVQ RDASKGYSIL QQTKLFDNII DLRIKLQKAV

     201  IAANKLPLTT ESWEEAKMDD SEETKRLLKE NEKLFNNLFN RLINFRIKFQ

     251  LGDHITQNEE VAKHKLSKKR SLKELYQETN SLDSELKEYR TAVLNKWSTK

     301  VSSASGNAAL SSNKFKAINL PADVQVENQL SDMSRLMKRT KLNRRNITPL

     351  YFQKDCANGR LPELISPVVK DSVDDNENSD DGLDIPKNYD PRRKDNNAID

     401  ITENPYVFDD EDFYRVLLND LIDKKISNAH NSESAAITIT STNARSNNKL

     451  KKNIDTKASK GRKLNYSVQD PIANYEAPIT SGYKWSDDQI DEFFAGLLGQ

     501  RVNFNENEDE EQHARIENDE ELEAVKNDDI QIFG*

Protein Sequence for MIT_Smik_c379_4611:

MIT_Smik_c379_4611  Length: 542  Mon Nov  7 15:06:22 2016  Type: P  Check: 1045  ..

       1  MGKSLADQIS DIAIKPVNKD FDIEDAENTS LFQHNEKIGE SDGSDYEDAN

      51  TEQTRKAHYV EVEKSTLRAE KGLELNDPKY TGVKGSRQAL YDELSDSAED

     101  DNEDSQEEDE EGKDEEEEGD ALSFRTDSED EQAENEVEEA DIDGGEMEEA

     151  QQKRDALSKL VQQETKQAIN KLSQSVQRDA LKGYSILQQT KLFDNIIDLR

     201  IKLQKAVIAA NKLPLTAESW KEAKMENSKE TKHLLNENEI LFNKLFNQLI

     251  NFRIKFQIDD HITQREETAK HKISKKRSFK ELYKETDSLD SELKDYRNAV

     301  LNKWSTKVSS ASGNSALSSN KFKAINLPAD MQVENQLSDM SRLMKRTKLN

     351  RRNITPLYFQ KDCAAGRLSE LISSTVDNGV DDNENSDDGL DIPKNYDPRR

     401  KDNSAIDIAE NPYVFDDEDF YRVLLNDLID KKISNAHNSE SAAITITSAN

     451  SRSNNKLKKN IDTKASKGRK LNYSIQDPIA NYEAPITSGY KWSDDQIDEF

     501  FAGLLGQRVN FNENENEEQY AGEENDEESE AVKNDDIQIF G*


Protein Sequence for MIT_Spar_c108_4837:

MIT_Spar_c108_4837  Length: 536  Mon Nov  7 15:06:22 2016  Type: P  Check: 9692  ..

       1  MGKSLADQIS DIAIKPINKD FDIEDEENTS LFQHNEKNGE SDLSDYEDAN

      51  IEQTKKAHYF EVEKSKLRAE KGLELNDPKY TGVKGSRQAL YEEVSNNEEE

     101  GEEEEEDEED EEEDALSFRT DSEDEQVENE EEESDADGDE MEEAQQKRQA

     151  LSKLVQQETK HAINKLSQSV QRDASKGYSI LQQTKLFDNI IDLRIKLQKA

     201  VIAANKLPLT AESWEEAKMD DSQETKRLLK ENEKLFNNLF NQLINFRIKF

     251  LLGDHITRSE ETAKHKISKK RSVKELHKET DSLDLELKEY RSAVLNKWST

     301  KVSSASGNSA LSSNKFKAIN LPADVQVENQ LSDMSRLMKR TKLNRRNITP

     351  LYFQNDCANG RLPELTSPVV EDGVDDNENS DDGLDIPKNY DPRRKDNNAI

     401  DIAENPYVFD DEDFYRVLLN DLIDKKISNA HNSESAAITI TSANSRSSNK

     451  LKKNIDTKAS KGRKLNYSVQ DPIANYEAPI TSGYKWSDDQ IDEFFAGLLG

     501  QRVNFNENDD GEQNVGEEND EELEAVKNDD IQIFG*

Protein Sequence for WashU_Sbay_Contig630.1:

WashU_Sbay_Contig630.1  Length: 542  Mon Nov  7 15:06:22 2016  Type: P  Check: 6901  ..

       1  MGKSLADQIS DIAIKPVIKD YDIEDEENTS VFQHDENGAE SDLSDNEDIN

      51  REQAKKSHYL EVEKSALRAE KGLELNDPKY TGVKGSRQAL YDDSSNSEDM

     101  EDDENESGQD EQENDGEDDD ALSFRTDSED EQAEDEAEES DVDDDEMEEA

     151  AQKRSALSKL VQQETKQAIN KLSQSVQRDA TKGYSILQQT KLFDNIIDLR

     201  IKLQKAVITA NKLPLTSDSW KEAKMDGSKE TKHLLKENEK LFNNLFNQLV

     251  NFRIKFQLGD HITQSDESKK HKLSKKRSVK ELYKETDSLD LELKEYRNAV

     301  LNKWSTKVSS ASGNSALSSS KFKAINQPAD VQVENQLSDM SRLMKRTKLN

     351  RRNITPMYFQ KDWANGKLPE LASQNVEDGD DNNNNSDDGL DIPKNYDPRR

     401  KDNNSVDTSE NPYVFDDEDF YRVLLNDLID KKISNAHNSE SAAITITSAN

     451  SRSNNKLKKN VDTKASKGRK LNYSVQDPIA NYEAPISSGY KWSDDQIDEF

     501  FAGLMGQRVN FNEDEEEDQH VGEDNDAESE AVKNDDIQIF G*


Protein Sequence for WashU_Scas_Contig588.15:

WashU_Scas_Contig588.15  Length: 543  Mon Nov  7 15:06:22 2016  Type: P  Check: 7664  ..

       1  MTKKLLADKI AKKINKVAVP DFDIEDDERA VFEHNENANS SNDDLSDLDD

      51  EKEEELKSAH YVDVGKSKLR ANTLEIKDEK YQGSKGSRKD LFDNDNENVS

     101  DSGSSDEANN NEDDVSDSDD AISLKTDSED ELISESEEES GDSEAEEEDE

     151  DTELKRERLA KLVQQETKQV MNKLSQSIQR DAAKGYSIAN QNRLFDNIID

     201  MRIKLQKAVT NANKLPITKE SWNTYTVESK ETTKLLNKSS ELVNRVLGQL

     251  INFRKDFQRG DNINQDIDSN DETSLHDKKR SFDDLNKDTD NLDEHLTKYR

     301  RAVLHKWSSK VTATSGNSAL SSTKFKAINQ PTDKQVENQL ADLTRLRKRT

     351  YLNRRNLLPL GFQDDLKEKR LSYFQADADK AIDGEEEEDI NQDIPKNYDP

     401  RRKDNNAIDT TENPYIFDDE DFYRVLLSDV VDKKTSNVQY GSTENPTVTI

     451  SSRSNNKLKK NIDTKASKGR KLNYSVQDPI ANFEAPINSG YKWNDEQIDE

     501  FFAGLLGQRI NFNEDENEDD NNSGDDKEEL EAIKNDDIQI FG*


Protein Sequence for WashU_Skud_Contig2003.2:

WashU_Skud_Contig2003.2  Length: 541  Mon Nov  7 15:06:22 2016  Type: P  Check: 1561  ..

       1  MGKLLADQIS DIAIKPVNED FDIEDEENAS LFQHNEKGGE SDFSDNEDVN

      51  TEQAKKSHYL EVEKSKLRAE KGLELNDSKY TGVKGSRQAL YNEFSDDEED

     101  ENEKSQEEEN NDGEDDDALS FRTDSDDEQA EDEEKSDSDG DEMEEAQQKR

     151  NALSKLVQQE TKRAINKLSQ SVQKDASKGY SILQQTKLFD NIIDLRIKLQ

     201  KAVIAANRLP LTTESWKEAR MDNSRETKHL LKENEKLFNK LFNQLINFRI

     251  KFQIGDHIAQ SEEKAKHKIS NKRSVKELYK ETDTLDSELK EYRNAVLNKW

     301  STKVSSASGN SALSSNKFKA INLSADVQVE NQLSDMSRLM KRTKLNRRNI

     351  APLYFQKDWA SGKLPELASP NAKEEEEEDI DDNLLDDGLD IPKNYDPRRK

     401  DNNAIDTIEN PYVFDDEDFY RVLLNDLIDK KISNAHNSES AAITITSAGS

     451  RSNNKLKKNI DTKASKGRKL NYSIQDPIAN YEASIISGYK WSDDQIDEFF

     501  AGLLGQRVNF NENEDEHQHA GEDDNGDLEA VKNDDIQIFG *


Protein Sequence for WashU_Smik_Contig2775.3:

WashU_Smik_Contig2775.3  Length: 542  Mon Nov  7 15:06:22 2016  Type: P  Check: 1339  ..

       1  MGKSLADQIS DIAIKPVNKD FDIEDAENTS LFQHNEKIGE SDGSDYEDAN

      51  TEQTRKAHYV EVEKSTLRAE KGLELNDPKY TGVKGSRQAL YDELSDSAED

     101  DNEDSQEEDE EGKDEEEEGD ALSFRTDSED EQAENEVEEA DIDGGEMEEA

     151  QQKRDALSKL VQQETKQAIN KLSQSVQRDA LKGYSILQQT KLFDNIIDLR

     201  IKLQKAVIAA NKLPLTAESW KEAKMENSKE TKHLLNENEI LFNKLFNQLI

     251  NFRIKFQIDD HITQREETAK HKISKKRSFK ELYKETDSLD SELKDYRNAV

     301  LNKWSTKVSS ASGNSALSSN KFKAINLPAD MQVKNQLSDM SRLMKRTKLN

     351  RRNITPLYFQ KDCAAGRLSE LISSTVDNGV DDNENSDDGL DIPKNYDPRR

     401  KDNSAIDIAE NPYVFDDEDF YRVLLNDLID KKISNAHNSE SAAITITSAN

     451  SRSNNKLKKN IDTKASKGRK LNYSIQDPIA NYEAPITSGY KWSDDQIDEF

     501  FAGLLGQRVN FNENENEEQY AGEENDEESE AVKNDDIQIF G*