Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YDR294C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_DPL1/YDR294C   1   ----------------MSGVSNKTVSINGWYGMPIHLLREEGDFAQFMIL   34
MIT_Smik_c381_4629   1   ----------------MSGASNKTLSISGWYGMPFYLLREDCDFSQFMIL   34
MIT_Spar_c109_4816   1   ----------------MSGVSNKTLSTGSWYGMPIHLLREDCDFTQFMIL   34
MIT_Suva_c511_4854   1   --------------------MNTTLSSSEWYSTSIRLLVEEYDIKQFLIL   30
WashU_Sbay_Contig630.6   1   --------------------MNTTLSSSEWYSTSIRLLVEEYDIKQFLIL   30
WashU_Scas_Contig678.28   1   MSSSTATMDGAAAIIVPGTVPLWAMFLNWKDNTLDPFLNSFVLKTTDIPS   50
WashU_Skud_Contig2003.7   1   ----------------MSEVLNKSVLSSGWYGTAVRLLGEDCDFKRFLIL   34
Symbols






:: . . :* . :



SGD_Scer_DPL1/YDR294C   35   TINELKIAIHGYLRNTPWYNMLKDYLFVIFCYKLISNFFYLLKVYGPVRL   84
MIT_Smik_c381_4629   35   IIGESRKGIYDYFRNTPWYNMLKDYLFVIFCYKILSNFLYLLKVYGPIKL   84
MIT_Spar_c109_4816   35   TINESKRDVHDYFINTPWYNMVKDYLFVVFCYRLLSNFLYLLKVYGPVRL   84
MIT_Suva_c511_4854   31   TISELRRSIQDYLSNTPWHNILKDYLYFTFCYKLLSNFLYLLRVYGPIRL   80
WashU_Sbay_Contig630.6   31   TISELRRSIQDYLSNTPWHNILKDYLYFTFCYKLLSNFLYLLRVYGPIRL   80
WashU_Scas_Contig678.28   51   VMACTRHFITDYYYTHSWYDILKDYLLFCFIYGIVNKLWFNIKVYGVFGF   100
WashU_Skud_Contig2003.7   35   TISELRRGVYDYLTDTPWYNMLKDYLFVTFCYKLLSNLLYLLKVYGPVRL   84
Symbols






: : : .* .*::::**** . * * ::.:: : ::*** . :



SGD_Scer_DPL1/YDR294C   85   AVRTYEHSSRRLFRWLLDSPFLRGTVEKEVTKVKQSIEDELIRSDSQLMN   134
MIT_Smik_c381_4629   85   TVRTYEHTSRKLFRWLLNSPFLKGTVEKEVSKVKKSIEDELIRSDSQLMN   134
MIT_Spar_c109_4816   85   AVRTYEHTSRKLFRWLLDSPFLKGTVEKEVSKVKQSIEDELIRSDSQLMN   134
MIT_Suva_c511_4854   81   ARRTYEHTSRSIFRWLLDSPFLKGTVDKEVSKIKQSIEDELIRSDSQLMN   130
WashU_Sbay_Contig630.6   81   ARRTYEHTSRSIFRWLLDSPFLKGTVDKEVSKIKQSIEDELIRSDSQLMN   130
WashU_Scas_Contig678.28   101   IRRSYNIASKILFKKLLSSPLLKKKVDEQVQIAIDGIETGLIKDDSSLMH   150
WashU_Skud_Contig2003.7   85   AVRTYGHISRALFRWLLDSPFLKGSVEKEVSKVKQSIEDELIRSDSQLMN   134
Symbols






*:* *: :*: **.**:*: .*:::* ..** **:.**.**:



SGD_Scer_DPL1/YDR294C   135   FPQLPSNGIPQDDVIEELNKLNDLIPHTQWKEGKVSGAVYHGGDDLIHLQ   184
MIT_Smik_c381_4629   135   FPRLPSNGIPQNDVIEELNKLNDLIPHTQWKEGKVSGAVYHGGDDLIHLQ   184
MIT_Spar_c109_4816   135   FPRLPSNGIPQDDVIEELNKLNDLIPHTQWKEGKVSGAVYHGGDDLIHLQ   184
MIT_Suva_c511_4854   131   FPQLPSDGISQDEVVEELSKLNDLIPHTQWKEGKVSGAVYHGGDDLIHLQ   180
WashU_Sbay_Contig630.6   131   FPQLPSDGISQDEVVEELSKLNDLIPHTQWKEGKVSGAVYHGGDDLIHLQ   180
WashU_Scas_Contig678.28   151   FAALPKVGLAQEQVIEQLEKLNEVLPHTEWEEGRVSGAVYHGGSDLIHLQ   200
WashU_Skud_Contig2003.7   135   FPQLPSDGLPQDDVVEELNKLNDLIPHTQWKEGKVSGAVYHGGDDLIHLQ   184
Symbols






*. **. *:.*::*:*:*.***:::***:*:**:*********.******



SGD_Scer_DPL1/YDR294C   185   TIAYEKYCVANQLHPDVFPAVRKMESEVVSMVLRMFNAPSDTGCGTTTSG   234
MIT_Smik_c381_4629   185   TIAYEKYCVANQLHPDVFPAVRKMESEVVSMVLKMFNAPSDTGCGTTTSG   234
MIT_Spar_c109_4816   185   TIAYEKYCVANQLHPDVFPAVRKMESEVVSMVLRMFNAPSDTGCGTTTSG   234
MIT_Suva_c511_4854   181   TIAYEKYCVANQLHPDVFPAVRKMESEVVSMVLRMFNAPSDTGCGTTTSG   230
WashU_Sbay_Contig630.6   181   TIAYEKYCVANQLHPDVFPAVRKMESEVVSMVLRMFNAPSDTGCGTTTSG   230
WashU_Scas_Contig678.28   201   SVAFEKYCVANQLHPDVFPAVRKMEAEVVSMVLNMFNAPSDTGCGTTTSG   250
WashU_Skud_Contig2003.7   185   TIAYEKYCVANQLHPDVFPAVRKMESEVVSMVLRMFNAPSGAGCGTTTSG   234
Symbols






::*:*********************:*******.******.:********



SGD_Scer_DPL1/YDR294C   235   GTESLLLACLSAKMYALHHRGITEPEIIAPVTAHAGFDKAAYYFGMKLRH   284
MIT_Smik_c381_4629   235   GTESLLLACLSAKMYALHHRGITEPEIIAPVTAHAGFDKAAYYFGMKLRH   284
MIT_Spar_c109_4816   235   GTESLLLACLSAKMYALHHRGITEPEIIAPVTAHAGFDKAAYYFGMKLRH   284
MIT_Suva_c511_4854   231   GTESLLLACLSAKMHALHHRGITEPEIIAPITAHAGFDKAAYYFNMKLRH   280
WashU_Sbay_Contig630.6   231   GTESLLLACLSAKMHALHHRGITEPEIIAPITAHAGFDKAAYYFNMKLRH   280
WashU_Scas_Contig678.28   251   GTESLLLACLSAKMYGYHHKGITNPEMIIPVTAHAGFDKAAYYFGIKLHH   300
WashU_Skud_Contig2003.7   235   GTESLLLACLSAKMYALHHRGITEPEIIAPITAHAGFDKAAYYFGMKLRH   284
Symbols






**************:. **:***:**:* *:*************.:**:*



SGD_Scer_DPL1/YDR294C   285   VELDPTTYQVDLGKVKKFINKNTILLVGSAPNFPHGIADDIEGLGKIAQK   334
MIT_Smik_c381_4629   285   VDLDSTTYQVDLKKVKKFINKNTVLLVGSAPNFPHGIADDIEGLGEIAQK   334
MIT_Spar_c109_4816   285   VELDPTTYQADLKKVKKFINKNTVLLVGSAPNFPHGIADDIEGLGKIAQK   334
MIT_Suva_c511_4854   281   VELDPTTYQVDLKKVKKFINKNTVLLVGSAPNFPHGIADDIEGLGKIAQK   330
WashU_Sbay_Contig630.6   281   VELDPTTYQVDLKKVKKFINKNTVLLVGSAPNFPHGIADDIEGLGKIAQK   330
WashU_Scas_Contig678.28   301   VDLDPKTFKVDLKKVKKFINKNTVLLAGSVPNFPHGIDDDIVGLGKLAEK   350
WashU_Skud_Contig2003.7   285   VQLDPTTYQVDLKEVRKFINKNTVLLVGSAPNFPHGIADDIEGLGKIAQK   334
Symbols






*:**..*::.** :*:*******:**.**.******* *** ***::*:*



SGD_Scer_DPL1/YDR294C   335   YKLPLHVDSCLGSFIVSFMEKAGYKN---LPLLDFRVPGVTSISCDTHKY   381
MIT_Smik_c381_4629   335   YNLPLHVDSCLGSFIVSFMEKAGYKN---LPFLDFRVPGVTSISCDTHKY   381
MIT_Spar_c109_4816   335   YKLPLHVDSCLGSFIVSFMEKAGYKN---LPLLDFRVPGVTSISCDTHKY   381
MIT_Suva_c511_4854   331   HKLPLHVDSCLGSFIVSFMEKAGYKN---VPRLDFRVPGVTSISCDTHKY   377
WashU_Sbay_Contig630.6   331   HKLPLHVDSCLGSFIVSFMEKAGYKN---VPRLDFRVPGVTSISCDTHKY   377
WashU_Scas_Contig678.28   351   YSIPLHVDCCLGSFIVAFMEKAGFNKDGTLPLFDFRVPGVTSISCDTHKY   400
WashU_Skud_Contig2003.7   335   YKLPLHVDSCLGSFIVSFMEKAGYKN---LPFLDFRVPGVTSISCDTHKY   381
Symbols






:.:*****.*******:******::: :* :*****************



SGD_Scer_DPL1/YDR294C   382   GFAPKGSSVIMYRNSDLRMHQYYVNPAWTGGLYGSPTLAGSRPGAIVVGC   431
MIT_Smik_c381_4629   382   GFAPKGSSVIMYRNSDLRMHQYYVNPAWTGGLYGSPTLAGSRPGAIVVGC   431
MIT_Spar_c109_4816   382   GFAPKGSSVIMYRNSDLRMHQYYVNPAWTGGLYGSPTLAGSRPGAIVVGC   431
MIT_Suva_c511_4854   378   GFAPKGSSVIMYRNSDLRMHQYYVNPTWTGGLYGSPTLAGSRPGAIVVGC   427
WashU_Sbay_Contig630.6   378   GFAPKGSSVIMYRNSDLRMHQYYVNPTWTGGLYGSPTLAGSRPGAIVVGC   427
WashU_Scas_Contig678.28   401   GFAPKGSSVLMYRNADLRMHQYYVNPDWTGGLYGSSTLAGSRPGALVVGC   450
WashU_Skud_Contig2003.7   382   GFAPKGSSVIMYRNSDLRMHQYYVNPAWTGGLYGSPTLAGSRPGAIVVGC   431
Symbols






*********:****:*********** ********.*********:****



SGD_Scer_DPL1/YDR294C   432   WATMVNMGENGYIESCQEIVGAAMKFKKYIQENIPDLNIMGNPRYSVISF   481
MIT_Smik_c381_4629   432   WATMVNMGENGYIESCQEIVGAAMKFKSFIMENIPDLEIIGDPKYSVVSF   481
MIT_Spar_c109_4816   432   WATMVNMGENGYIESCREIVGAAMKFKEFIQESIPDLNIMGDPRYSVISF   481
MIT_Suva_c511_4854   428   WATMVNMGENGYIKSCQEIVGAAMKFKRFILENIPDLEVMGDPKYSVVSF   477
WashU_Sbay_Contig630.6   428   WATMVNMGENGYIKSCQEIVGAAMKFKRFILENIPDLEVMGDPKYSVVSF   477
WashU_Scas_Contig678.28   451   WSTMVNMGEAGYIQSCTDIIHATRKLKKYISTNLPELEIIGDPKFSVISF   500
WashU_Skud_Contig2003.7   432   WATMVNMGENGYIESCQEIVGAAMKFKRFILENIPDLKIMGDPKYSVVSF   481
Symbols






*:******* ***:** :*: *: *:* :* .:*:*:::*:*::**:**



SGD_Scer_DPL1/YDR294C   482   SSKTLNIHELSDRLSKKGWHFNALQKPVALHMAFTRLSAHVVDEICDILR   531
MIT_Smik_c381_4629   482   SSKTLNIHELSDRLAKKGWHFNALQKPTALHMAFTRLSANVVDDICNILR   531
MIT_Spar_c109_4816   482   SSKTLNIHELSDRLAKKGWHFNALQKPIALHMAFTRLSANVVDEICDILR   531
MIT_Suva_c511_4854   478   SSKTLNIHELSDRLAKKGWHFNALQKPVALHMAFTRLSAHVVDEICDVLR   527
WashU_Sbay_Contig630.6   478   SSKTLNIHELSDRLAKKGWHFNALQKPVALHMAFTRLSAHVVDEICDVLR   527
WashU_Scas_Contig678.28   501   KSNKIDIYELSDRLAKGGWHLNALQNPPALHLAVTRLTIPSIDSLCEILD   550
WashU_Skud_Contig2003.7   482   SSRTLNIHELSDKLAKKGWHFNALQKPVALHMAFTRLNANVVDEICEILR   531
Symbols






.*..::*:****:*:* ***:****:* ***:*.***. :*.:*::*



SGD_Scer_DPL1/YDR294C   532   TTVQELKSESNSKPSPDGTSALYGVAGSVKTAGVADKLIVGFLDALYKLG   581
MIT_Smik_c381_4629   532   TTVQESRSESNTKPSPDGTSALYGVAGSVKTAGVADKLIVGFLDSLYKLG   581
MIT_Spar_c109_4816   532   TTVQELKSESNSKPSPDGTSALYGVAGSVKTAGVADKLIVGFLDALYKLG   581
MIT_Suva_c511_4854   528   TTVQELKSESGSKPSPDGTSALYGVAGSVKTAGVADKLIVGFLDALYKLG   577
WashU_Sbay_Contig630.6   528   TTVQELKSESGSKPSPDGTSALYGVAGSVKTAGVADKLIVGFLDALYKLG   577
WashU_Scas_Contig678.28   551   KEVTSMKNAPGAKPSSDSTSALYGIAGSVKTTGVADRLIVGFLDTLYKLK   600
WashU_Skud_Contig2003.7   532   TTVQELKRESDSKPSPDGTSALYGVAGSVKTAGVADKLIVGFLDALYKLG   581
Symbols






. * . : ..:***.*.******:******:****:*******:****



SGD_Scer_DPL1/YDR294C   582   PGEDTATK   589
MIT_Smik_c381_4629   582   PGEETDTE   589
MIT_Spar_c109_4816   582   PGEETVTK   589
MIT_Suva_c511_4854   578   PAEDADAK   585
WashU_Sbay_Contig630.6   578   PAEDADAK   585
WashU_Scas_Contig678.28   601   PGE-----   603
WashU_Skud_Contig2003.7   582   PGEDADAT   589
Symbols






*.*



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_DPL1/YDR294C:

SGD_Scer_DPL1/YDR294C  Length: 590  Mon Nov  7 15:06:16 2016  Type: P  Check: 6718  ..

       1  MSGVSNKTVS INGWYGMPIH LLREEGDFAQ FMILTINELK IAIHGYLRNT

      51  PWYNMLKDYL FVIFCYKLIS NFFYLLKVYG PVRLAVRTYE HSSRRLFRWL

     101  LDSPFLRGTV EKEVTKVKQS IEDELIRSDS QLMNFPQLPS NGIPQDDVIE

     151  ELNKLNDLIP HTQWKEGKVS GAVYHGGDDL IHLQTIAYEK YCVANQLHPD

     201  VFPAVRKMES EVVSMVLRMF NAPSDTGCGT TTSGGTESLL LACLSAKMYA

     251  LHHRGITEPE IIAPVTAHAG FDKAAYYFGM KLRHVELDPT TYQVDLGKVK

     301  KFINKNTILL VGSAPNFPHG IADDIEGLGK IAQKYKLPLH VDSCLGSFIV

     351  SFMEKAGYKN LPLLDFRVPG VTSISCDTHK YGFAPKGSSV IMYRNSDLRM

     401  HQYYVNPAWT GGLYGSPTLA GSRPGAIVVG CWATMVNMGE NGYIESCQEI

     451  VGAAMKFKKY IQENIPDLNI MGNPRYSVIS FSSKTLNIHE LSDRLSKKGW

     501  HFNALQKPVA LHMAFTRLSA HVVDEICDIL RTTVQELKSE SNSKPSPDGT

     551  SALYGVAGSV KTAGVADKLI VGFLDALYKL GPGEDTATK*

Protein Sequence for MIT_Smik_c381_4629:

MIT_Smik_c381_4629  Length: 590  Mon Nov  7 15:06:16 2016  Type: P  Check: 7481  ..

       1  MSGASNKTLS ISGWYGMPFY LLREDCDFSQ FMILIIGESR KGIYDYFRNT

      51  PWYNMLKDYL FVIFCYKILS NFLYLLKVYG PIKLTVRTYE HTSRKLFRWL

     101  LNSPFLKGTV EKEVSKVKKS IEDELIRSDS QLMNFPRLPS NGIPQNDVIE

     151  ELNKLNDLIP HTQWKEGKVS GAVYHGGDDL IHLQTIAYEK YCVANQLHPD

     201  VFPAVRKMES EVVSMVLKMF NAPSDTGCGT TTSGGTESLL LACLSAKMYA

     251  LHHRGITEPE IIAPVTAHAG FDKAAYYFGM KLRHVDLDST TYQVDLKKVK

     301  KFINKNTVLL VGSAPNFPHG IADDIEGLGE IAQKYNLPLH VDSCLGSFIV

     351  SFMEKAGYKN LPFLDFRVPG VTSISCDTHK YGFAPKGSSV IMYRNSDLRM

     401  HQYYVNPAWT GGLYGSPTLA GSRPGAIVVG CWATMVNMGE NGYIESCQEI

     451  VGAAMKFKSF IMENIPDLEI IGDPKYSVVS FSSKTLNIHE LSDRLAKKGW

     501  HFNALQKPTA LHMAFTRLSA NVVDDICNIL RTTVQESRSE SNTKPSPDGT

     551  SALYGVAGSV KTAGVADKLI VGFLDSLYKL GPGEETDTE*

Protein Sequence for MIT_Spar_c109_4816:

MIT_Spar_c109_4816  Length: 590  Mon Nov  7 15:06:16 2016  Type: P  Check: 6996  ..

       1  MSGVSNKTLS TGSWYGMPIH LLREDCDFTQ FMILTINESK RDVHDYFINT

      51  PWYNMVKDYL FVVFCYRLLS NFLYLLKVYG PVRLAVRTYE HTSRKLFRWL

     101  LDSPFLKGTV EKEVSKVKQS IEDELIRSDS QLMNFPRLPS NGIPQDDVIE

     151  ELNKLNDLIP HTQWKEGKVS GAVYHGGDDL IHLQTIAYEK YCVANQLHPD

     201  VFPAVRKMES EVVSMVLRMF NAPSDTGCGT TTSGGTESLL LACLSAKMYA

     251  LHHRGITEPE IIAPVTAHAG FDKAAYYFGM KLRHVELDPT TYQADLKKVK

     301  KFINKNTVLL VGSAPNFPHG IADDIEGLGK IAQKYKLPLH VDSCLGSFIV

     351  SFMEKAGYKN LPLLDFRVPG VTSISCDTHK YGFAPKGSSV IMYRNSDLRM

     401  HQYYVNPAWT GGLYGSPTLA GSRPGAIVVG CWATMVNMGE NGYIESCREI

     451  VGAAMKFKEF IQESIPDLNI MGDPRYSVIS FSSKTLNIHE LSDRLAKKGW

     501  HFNALQKPIA LHMAFTRLSA NVVDEICDIL RTTVQELKSE SNSKPSPDGT

     551  SALYGVAGSV KTAGVADKLI VGFLDALYKL GPGEETVTK*

Protein Sequence for MIT_Suva_c511_4854:

MIT_Suva_c511_4854  Length: 586  Mon Nov  7 15:06:16 2016  Type: P  Check: 2522  ..

       1  MNTTLSSSEW YSTSIRLLVE EYDIKQFLIL TISELRRSIQ DYLSNTPWHN

      51  ILKDYLYFTF CYKLLSNFLY LLRVYGPIRL ARRTYEHTSR SIFRWLLDSP

     101  FLKGTVDKEV SKIKQSIEDE LIRSDSQLMN FPQLPSDGIS QDEVVEELSK

     151  LNDLIPHTQW KEGKVSGAVY HGGDDLIHLQ TIAYEKYCVA NQLHPDVFPA

     201  VRKMESEVVS MVLRMFNAPS DTGCGTTTSG GTESLLLACL SAKMHALHHR

     251  GITEPEIIAP ITAHAGFDKA AYYFNMKLRH VELDPTTYQV DLKKVKKFIN

     301  KNTVLLVGSA PNFPHGIADD IEGLGKIAQK HKLPLHVDSC LGSFIVSFME

     351  KAGYKNVPRL DFRVPGVTSI SCDTHKYGFA PKGSSVIMYR NSDLRMHQYY

     401  VNPTWTGGLY GSPTLAGSRP GAIVVGCWAT MVNMGENGYI KSCQEIVGAA

     451  MKFKRFILEN IPDLEVMGDP KYSVVSFSSK TLNIHELSDR LAKKGWHFNA

     501  LQKPVALHMA FTRLSAHVVD EICDVLRTTV QELKSESGSK PSPDGTSALY

     551  GVAGSVKTAG VADKLIVGFL DALYKLGPAE DADAK*

Protein Sequence for WashU_Sbay_Contig630.6:

WashU_Sbay_Contig630.6  Length: 586  Mon Nov  7 15:06:16 2016  Type: P  Check: 2522  ..

       1  MNTTLSSSEW YSTSIRLLVE EYDIKQFLIL TISELRRSIQ DYLSNTPWHN

      51  ILKDYLYFTF CYKLLSNFLY LLRVYGPIRL ARRTYEHTSR SIFRWLLDSP

     101  FLKGTVDKEV SKIKQSIEDE LIRSDSQLMN FPQLPSDGIS QDEVVEELSK

     151  LNDLIPHTQW KEGKVSGAVY HGGDDLIHLQ TIAYEKYCVA NQLHPDVFPA

     201  VRKMESEVVS MVLRMFNAPS DTGCGTTTSG GTESLLLACL SAKMHALHHR

     251  GITEPEIIAP ITAHAGFDKA AYYFNMKLRH VELDPTTYQV DLKKVKKFIN

     301  KNTVLLVGSA PNFPHGIADD IEGLGKIAQK HKLPLHVDSC LGSFIVSFME

     351  KAGYKNVPRL DFRVPGVTSI SCDTHKYGFA PKGSSVIMYR NSDLRMHQYY

     401  VNPTWTGGLY GSPTLAGSRP GAIVVGCWAT MVNMGENGYI KSCQEIVGAA

     451  MKFKRFILEN IPDLEVMGDP KYSVVSFSSK TLNIHELSDR LAKKGWHFNA

     501  LQKPVALHMA FTRLSAHVVD EICDVLRTTV QELKSESGSK PSPDGTSALY

     551  GVAGSVKTAG VADKLIVGFL DALYKLGPAE DADAK*

Protein Sequence for WashU_Scas_Contig678.28:

WashU_Scas_Contig678.28  Length: 604  Mon Nov  7 15:06:16 2016  Type: P  Check: 3450  ..

       1  MSSSTATMDG AAAIIVPGTV PLWAMFLNWK DNTLDPFLNS FVLKTTDIPS

      51  VMACTRHFIT DYYYTHSWYD ILKDYLLFCF IYGIVNKLWF NIKVYGVFGF

     101  IRRSYNIASK ILFKKLLSSP LLKKKVDEQV QIAIDGIETG LIKDDSSLMH

     151  FAALPKVGLA QEQVIEQLEK LNEVLPHTEW EEGRVSGAVY HGGSDLIHLQ

     201  SVAFEKYCVA NQLHPDVFPA VRKMEAEVVS MVLNMFNAPS DTGCGTTTSG

     251  GTESLLLACL SAKMYGYHHK GITNPEMIIP VTAHAGFDKA AYYFGIKLHH

     301  VDLDPKTFKV DLKKVKKFIN KNTVLLAGSV PNFPHGIDDD IVGLGKLAEK

     351  YSIPLHVDCC LGSFIVAFME KAGFNKDGTL PLFDFRVPGV TSISCDTHKY

     401  GFAPKGSSVL MYRNADLRMH QYYVNPDWTG GLYGSSTLAG SRPGALVVGC

     451  WSTMVNMGEA GYIQSCTDII HATRKLKKYI STNLPELEII GDPKFSVISF

     501  KSNKIDIYEL SDRLAKGGWH LNALQNPPAL HLAVTRLTIP SIDSLCEILD

     551  KEVTSMKNAP GAKPSSDSTS ALYGIAGSVK TTGVADRLIV GFLDTLYKLK

     601  PGE*

Protein Sequence for WashU_Skud_Contig2003.7:

WashU_Skud_Contig2003.7  Length: 590  Mon Nov  7 15:06:16 2016  Type: P  Check: 5333  ..

       1  MSEVLNKSVL SSGWYGTAVR LLGEDCDFKR FLILTISELR RGVYDYLTDT

      51  PWYNMLKDYL FVTFCYKLLS NLLYLLKVYG PVRLAVRTYG HISRALFRWL

     101  LDSPFLKGSV EKEVSKVKQS IEDELIRSDS QLMNFPQLPS DGLPQDDVVE

     151  ELNKLNDLIP HTQWKEGKVS GAVYHGGDDL IHLQTIAYEK YCVANQLHPD

     201  VFPAVRKMES EVVSMVLRMF NAPSGAGCGT TTSGGTESLL LACLSAKMYA

     251  LHHRGITEPE IIAPITAHAG FDKAAYYFGM KLRHVQLDPT TYQVDLKEVR

     301  KFINKNTVLL VGSAPNFPHG IADDIEGLGK IAQKYKLPLH VDSCLGSFIV

     351  SFMEKAGYKN LPFLDFRVPG VTSISCDTHK YGFAPKGSSV IMYRNSDLRM

     401  HQYYVNPAWT GGLYGSPTLA GSRPGAIVVG CWATMVNMGE NGYIESCQEI

     451  VGAAMKFKRF ILENIPDLKI MGDPKYSVVS FSSRTLNIHE LSDKLAKKGW

     501  HFNALQKPVA LHMAFTRLNA NVVDEICEIL RTTVQELKRE SDSKPSPDGT

     551  SALYGVAGSV KTAGVADKLI VGFLDALYKL GPGEDADAT*