Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YDR279W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_RNH202/YDR279W   1   -----------------MTVSNIGGEERLIILP--DDYETSKTINTFTLP   31
MIT_Smik_c386_4677   1   -----------------MTISDIEGEERIIILP--DDYDVSKNINSFTLP   31
MIT_Spar_c111_4770   1   -----------------MTISDIGSEGRVIILP--DGYEASKNINTFTLP   31
MIT_Suva_c508_4784   1   MIQPSSPTISKTFKNQIMTIAKTGGEERLIILP--DECDASKIINTFTLP   48
WashU_Sbay_Contig630.21   1   -----------------MTIAKTGGEERLIILP--DECDASKIINTFTLP   31
WashU_Scas_Contig678.16   1   ----------------MTINQEEQNTQKLVILPNSLTKNANTSIQVFSLP   34
WashU_Sklu_Contig2394.5   1   -----------MKNNKKMSTSGINKERRVLVLP----STIDSDLKLIKLP   35
WashU_Skud_Contig1845.8   1   -----------------MSTCDIGGEERLLILP--DECDASKNINTFTLP   31
WashU_Smik_Contig2790.6   1   -----------------MTISDIEGEERIIILP--DDYDVSKNINSFTLP   31
Symbols






::::** .. :: :.**



SGD_Scer_RNH202/YDR279W   32   PPSNITSKPRIELFENINGKLYEIRSFQFGKGPSYSHEEDLANDKYHYTK   81
MIT_Smik_c386_4677   32   PPSNIASKPRIELFEDTNGKVYEIKSYQFGKGPSYSHEEDLANDKYHYTK   81
MIT_Spar_c111_4770   32   PPSNITSKHRIELFEDISGKLYEIRSFQFGKGPSYSHEEDLANDKYHYTK   81
MIT_Suva_c508_4784   49   PCSNIESKPLIELFENTDGRLYQVKSFQFGKGPSYSHNEDLANDKYHYAK   98
WashU_Sbay_Contig630.21   32   PCSNIESKPLIELFENTDGRLYQVKSFQFGKGPSYSHNEDLANDKYHYAK   81
WashU_Scas_Contig678.16   35   HPSNITSKPRIALIQGIDNQLFQVHTHSFGRSSAYNYRSDLANEKYHYTK   84
WashU_Sklu_Contig2394.5   36   HPSNNLSKEPIIIFHHN-GKCYRLNTHTFSKGSQYNQAKDLSTEKYHYTN   84
WashU_Skud_Contig1845.8   32   PSCNIASKPRLEIFENTDGKLYEIKCFQFGKGPSYSEEEDLANDKYHYTR   81
WashU_Smik_Contig2790.6   32   PPSNIASKPRIELFEDTNGKVYEIKSYQFGKGPSYSHEEDLANDKYHYTK   81
Symbols






.* ** : ::. .: :.:. . *.:.. *. .**:.:****:.



SGD_Scer_RNH202/YDR279W   82   ENHPIKSTFIVNTSDPTDGYVFNSSKIHFCSLYDIAFSLIGFYYRNSVSA   131
MIT_Smik_c386_4677   82   ENHPIKSTFIVNTSDPADGYIFKSSKIHFCCLHDVTFSLIGFYYRNSISE   131
MIT_Spar_c111_4770   82   ENHPIKSTFIVNTSNPSEGYVFKSSKIYFCSLHDITFSLIGFYYKNSVTA   131
MIT_Suva_c508_4784   99   DDHPIKSTFIVNNSNPADGCILNSSKLYFCTLHDVVFSLIGFHYRTSVAE   148
WashU_Sbay_Contig630.21   82   DDHPIKSTFIVNNSNPADGCILNSSKLYFCTLHDVVFSLIGFHYRTSVAE   131
WashU_Scas_Contig678.16   85   DSKPVKSTFLVNEEHREDGYILESSEFQFTTKYNVVFNLIGFFFKDASEV   134
WashU_Sklu_Contig2394.5   85   EQNPLKSTFLTNKSDRMDGYILESGDFHYSTKYDLCFSLCGAYYSENITQ   134
WashU_Skud_Contig1845.8   82   ENNPIKSALMVNTSDSADGYIFKSSKIYFCTLYDIAFSLIGFHYKNSISA   131
WashU_Smik_Contig2790.6   82   ENHPIKSTFIVNTSDPADGYIFKSSKIHFCCLHDVTFSLIGFYYRNSISE   131
Symbols






:.:*:**:::.* .. :* :::*..: : ::: *.* * .:



SGD_Scer_RNH202/YDR279W   132   DEQDYSNSSDTGENQKSNSKTNEKFLTVRDYHDFLTDNHDKNWENISLSR   181
MIT_Smik_c386_4677   132   DEQDYVNSNDTSVNQTSNKKNHERFLTARDHHDFLTDNHDKNWDNISLSC   181
MIT_Spar_c111_4770   132   DEQDYANSSDTNDNQSSSSKNHERFLTVRDYHDLLTDTHDKNWDSISLSC   181
MIT_Suva_c508_4784   149   DEQDYVQPSDTGENQTANRKDHERFLTVRDYHDLLTDNHAKNWNHISLRC   198
WashU_Sbay_Contig630.21   132   DEQDYVQPSDTGENQTANRKDHERFLTVRDYHDLLTDNHAKNWNHISLRC   181
WashU_Scas_Contig678.16   135   EQECDYIKPLVKN---ETIKVDDKFLPLRDYHDLLVDTYDKQWMNISLKT   181
WashU_Sklu_Contig2394.5   135   SESDYLN-----KYTGNSVEHDNRFLTVRDFQDLLIDKHDQQWSHVSVEA   179
WashU_Skud_Contig1845.8   132   DEQDYVKSSNTDEEQTAERKEHERFLTLRDYHDLLTDNHDKNWNNISLGS   181
WashU_Smik_Contig2790.6   132   DEQDYVNSNDTSVNQTSNKKNHERFLTARDHHDFLTDNHDKNWDNISLSC   181
Symbols






.:. : .::**. **.:*:* *.: ::* :*:



SGD_Scer_RNH202/YDR279W   182   LKSGLAKVSETIEEAGDVYYKITSAMITQFLLGKVSKIVENFPPSIPTLK   231
MIT_Smik_c386_4677   182   LRGGLAKISETIEEAGEVYYKITPAMITKYLVEKVSKIAENFPPSVPILK   231
MIT_Spar_c111_4770   182   LKSGLTKVSETIEECGDVYYKITPAMITKYLVGKVSKIVKNFPPSIPTLK   231
MIT_Suva_c508_4784   199   LESGLTKISETIEEAGEIYYKITPALITRYLVGKVLKITENFPPSFPILK   248
WashU_Sbay_Contig630.21   182   LESGLTKISETIEEAGEIYYKITPALITRYLVGKVLKITENFPPSFPILK   231
WashU_Scas_Contig678.16   182   LENALSEISEVIEEAGDKYYKITREKITNVLISRVQKIVENFPKSLPIPI   231
WashU_Sklu_Contig2394.5   180   LESALTEISDSIEEAGDTYHKITIEKVVEWLMRKVSKIVDNFPQTLPMEK   229
WashU_Skud_Contig1845.8   182   LKCGLAKISETIEEAGDVYYKITPAMITQYLAGKVAKVIENFPPSIPTLK   231
WashU_Smik_Contig2790.6   182   LRGGLAKISETIEEAGEVYYKITPAMITKYLVEKVSKIAENFPPSVPILK   231
Symbols






*. .*:::*: ***.*: *:*** :.. * :* *: .*** :.*



SGD_Scer_RNH202/YDR279W   232   NAPTEIKQCYKVVMATNLLVSLIPRAAYHNLLTFSPTMDSGCLNPDIKAS   281
MIT_Smik_c386_4677   232   HATTEIEQCYKVVVATNLLVSLIPRAAYHNLVDFSPTMGSYCSDLDIKAS   281
MIT_Spar_c111_4770   232   NVPTEIEQSYKVVTATSLLISLIPRAAYHNLVTFSPTMASSCTNLDIKAS   281
MIT_Suva_c508_4784   249   HAPAEIVQCYKVVMATNLLVSLIPKAAYRNLIEFSPSTTDCNFSLEIKAS   298
WashU_Sbay_Contig630.21   232   HAPAEIVQCYKVVMATNLLVSLIPKAAYRNLIEFSPSTTDCNFSLEIKAS   281
WashU_Scas_Contig678.16   232   DYPDEIKHCAKVTLACNLLISLIPKMAYEDLIVFE---SSDDAKLNISGL   278
WashU_Sklu_Contig2394.5   230   NMPADITSYAKIVYSCNLLVSLIPQLVYR------ALITSKNDILDIAGA   273
WashU_Skud_Contig1845.8   232   HAPVEITQCHKVVIAVNLLVSLIPKAAYHNLVEFSPTTTDTFFNLHIKAS   281
WashU_Smik_Contig2790.6   232   HATTEIEQCYKVVVATNLLVSLIPRAAYHNLVDFSPTMGSYCSDLDIKAS   281
Symbols






. . :* *:. : .**:****: .*. . .* .



SGD_Scer_RNH202/YDR279W   282   FIELENYETTNELQNAERELLMKSAMNVGLNSNGRVSLPVKKVTKKIVQN   331
MIT_Smik_c386_4677   282   FTSLEDYETKNELKNAEKELLMKSAMNVGLNTNSRASLSIKKVTKKVVQS   331
MIT_Spar_c111_4770   282   FIDLENYEITKESQNAEKELLMKSAVNVGLSSNGSVSLSVKKVTKKVIQS   331
MIT_Suva_c508_4784   299   FTNLENYQATNELKNVEKELLMKSAMNVGIGTNG-GSVSVKKVAKKVVLS   347
WashU_Sbay_Contig630.21   282   FTNLENYQATNELKNVEKELLMKSAMNVGIGTNG-GSVSVKKVAKKVVLS   330
WashU_Scas_Contig678.16   279   ISKFKKYEDEHAAAIVEKDILINAAISVGLGENSGKRNKVSKPVIKKKEV   328
WashU_Sklu_Contig2394.5   274   FTKYTEYIETTLQEEKEKEILLQAAVKTGLGNSETKKLGVKKVVISKRIA   323
WashU_Skud_Contig1845.8   282   FTDLEKYETTNELKNAEKELLMKSATNIGLGSNGSVSVAMKKVTKKIPQS   331
WashU_Smik_Contig2790.6   282   FTSLEDYETKNELKNAEKELLMKSAMNVGLNTNSRASLSIKKVTKKVVQS   331
Symbols






: . .* *:::*:::* . *:. . :.* . .



SGD_Scer_RNH202/YDR279W   332   KKPKVAIGKGAIDGFFKRK-   350
MIT_Smik_c386_4677   332   KKLKVATGKGAIDGFFKRK-   350
MIT_Spar_c111_4770   332   KRPKVAIGKGAIDGFFKRK-   350
MIT_Suva_c508_4784   348   KKPRVAIGKGAIDGFFKRK-   366
WashU_Sbay_Contig630.21   331   KKPRVAIGKGAIDGFFKRK-   349
WashU_Scas_Contig678.16   329   IKKKVAIGKGAIDGFFKKGK   348
WashU_Sklu_Contig2394.5   324   KVKKITVGKGAIDGFFKKKK   343
WashU_Skud_Contig1845.8   332   NRTRVAIGKGAIDGFFKRK-   350
WashU_Smik_Contig2790.6   332   KKLKVATGKGAIDGFFKRK-   350
Symbols






::: **********:



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_RNH202/YDR279W:

SGD_Scer_RNH202/YDR279W  Length: 351  Mon Nov  7 15:05:54 2016  Type: P  Check: 3772  ..

       1  MTVSNIGGEE RLIILPDDYE TSKTINTFTL PPPSNITSKP RIELFENING

      51  KLYEIRSFQF GKGPSYSHEE DLANDKYHYT KENHPIKSTF IVNTSDPTDG

     101  YVFNSSKIHF CSLYDIAFSL IGFYYRNSVS ADEQDYSNSS DTGENQKSNS

     151  KTNEKFLTVR DYHDFLTDNH DKNWENISLS RLKSGLAKVS ETIEEAGDVY

     201  YKITSAMITQ FLLGKVSKIV ENFPPSIPTL KNAPTEIKQC YKVVMATNLL

     251  VSLIPRAAYH NLLTFSPTMD SGCLNPDIKA SFIELENYET TNELQNAERE

     301  LLMKSAMNVG LNSNGRVSLP VKKVTKKIVQ NKKPKVAIGK GAIDGFFKRK

     351  *

Protein Sequence for MIT_Smik_c386_4677:

MIT_Smik_c386_4677  Length: 351  Mon Nov  7 15:05:54 2016  Type: P  Check: 602  ..

       1  MTISDIEGEE RIIILPDDYD VSKNINSFTL PPPSNIASKP RIELFEDTNG

      51  KVYEIKSYQF GKGPSYSHEE DLANDKYHYT KENHPIKSTF IVNTSDPADG

     101  YIFKSSKIHF CCLHDVTFSL IGFYYRNSIS EDEQDYVNSN DTSVNQTSNK

     151  KNHERFLTAR DHHDFLTDNH DKNWDNISLS CLRGGLAKIS ETIEEAGEVY

     201  YKITPAMITK YLVEKVSKIA ENFPPSVPIL KHATTEIEQC YKVVVATNLL

     251  VSLIPRAAYH NLVDFSPTMG SYCSDLDIKA SFTSLEDYET KNELKNAEKE

     301  LLMKSAMNVG LNTNSRASLS IKKVTKKVVQ SKKLKVATGK GAIDGFFKRK

     351  *

Protein Sequence for MIT_Spar_c111_4770:

MIT_Spar_c111_4770  Length: 351  Mon Nov  7 15:05:54 2016  Type: P  Check: 7007  ..

       1  MTISDIGSEG RVIILPDGYE ASKNINTFTL PPPSNITSKH RIELFEDISG

      51  KLYEIRSFQF GKGPSYSHEE DLANDKYHYT KENHPIKSTF IVNTSNPSEG

     101  YVFKSSKIYF CSLHDITFSL IGFYYKNSVT ADEQDYANSS DTNDNQSSSS

     151  KNHERFLTVR DYHDLLTDTH DKNWDSISLS CLKSGLTKVS ETIEECGDVY

     201  YKITPAMITK YLVGKVSKIV KNFPPSIPTL KNVPTEIEQS YKVVTATSLL

     251  ISLIPRAAYH NLVTFSPTMA SSCTNLDIKA SFIDLENYEI TKESQNAEKE

     301  LLMKSAVNVG LSSNGSVSLS VKKVTKKVIQ SKRPKVAIGK GAIDGFFKRK

     351  *

Protein Sequence for MIT_Suva_c508_4784:

MIT_Suva_c508_4784  Length: 367  Mon Nov  7 15:05:54 2016  Type: P  Check: 895  ..

       1  MIQPSSPTIS KTFKNQIMTI AKTGGEERLI ILPDECDASK IINTFTLPPC

      51  SNIESKPLIE LFENTDGRLY QVKSFQFGKG PSYSHNEDLA NDKYHYAKDD

     101  HPIKSTFIVN NSNPADGCIL NSSKLYFCTL HDVVFSLIGF HYRTSVAEDE

     151  QDYVQPSDTG ENQTANRKDH ERFLTVRDYH DLLTDNHAKN WNHISLRCLE

     201  SGLTKISETI EEAGEIYYKI TPALITRYLV GKVLKITENF PPSFPILKHA

     251  PAEIVQCYKV VMATNLLVSL IPKAAYRNLI EFSPSTTDCN FSLEIKASFT

     301  NLENYQATNE LKNVEKELLM KSAMNVGIGT NGGSVSVKKV AKKVVLSKKP

     351  RVAIGKGAID GFFKRK*

Protein Sequence for WashU_Sbay_Contig630.21:

WashU_Sbay_Contig630.21  Length: 350  Mon Nov  7 15:05:54 2016  Type: P  Check: 9309  ..

       1  MTIAKTGGEE RLIILPDECD ASKIINTFTL PPCSNIESKP LIELFENTDG

      51  RLYQVKSFQF GKGPSYSHNE DLANDKYHYA KDDHPIKSTF IVNNSNPADG

     101  CILNSSKLYF CTLHDVVFSL IGFHYRTSVA EDEQDYVQPS DTGENQTANR

     151  KDHERFLTVR DYHDLLTDNH AKNWNHISLR CLESGLTKIS ETIEEAGEIY

     201  YKITPALITR YLVGKVLKIT ENFPPSFPIL KHAPAEIVQC YKVVMATNLL

     251  VSLIPKAAYR NLIEFSPSTT DCNFSLEIKA SFTNLENYQA TNELKNVEKE

     301  LLMKSAMNVG IGTNGGSVSV KKVAKKVVLS KKPRVAIGKG AIDGFFKRK*


Protein Sequence for WashU_Scas_Contig678.16:

WashU_Scas_Contig678.16  Length: 349  Mon Nov  7 15:05:54 2016  Type: P  Check: 7149  ..

       1  MTINQEEQNT QKLVILPNSL TKNANTSIQV FSLPHPSNIT SKPRIALIQG

      51  IDNQLFQVHT HSFGRSSAYN YRSDLANEKY HYTKDSKPVK STFLVNEEHR

     101  EDGYILESSE FQFTTKYNVV FNLIGFFFKD ASEVEQECDY IKPLVKNETI

     151  KVDDKFLPLR DYHDLLVDTY DKQWMNISLK TLENALSEIS EVIEEAGDKY

     201  YKITREKITN VLISRVQKIV ENFPKSLPIP IDYPDEIKHC AKVTLACNLL

     251  ISLIPKMAYE DLIVFESSDD AKLNISGLIS KFKKYEDEHA AAIVEKDILI

     301  NAAISVGLGE NSGKRNKVSK PVIKKKEVIK KKVAIGKGAI DGFFKKGK*


Protein Sequence for WashU_Sklu_Contig2394.5:

WashU_Sklu_Contig2394.5  Length: 344  Mon Nov  7 15:05:54 2016  Type: P  Check: 8468  ..

       1  MKNNKKMSTS GINKERRVLV LPSTIDSDLK LIKLPHPSNN LSKEPIIIFH

      51  HNGKCYRLNT HTFSKGSQYN QAKDLSTEKY HYTNEQNPLK STFLTNKSDR

     101  MDGYILESGD FHYSTKYDLC FSLCGAYYSE NITQSESDYL NKYTGNSVEH

     151  DNRFLTVRDF QDLLIDKHDQ QWSHVSVEAL ESALTEISDS IEEAGDTYHK

     201  ITIEKVVEWL MRKVSKIVDN FPQTLPMEKN MPADITSYAK IVYSCNLLVS

     251  LIPQLVYRAL ITSKNDILDI AGAFTKYTEY IETTLQEEKE KEILLQAAVK

     301  TGLGNSETKK LGVKKVVISK RIAKVKKITV GKGAIDGFFK KKK*


Protein Sequence for WashU_Skud_Contig1845.8:

WashU_Skud_Contig1845.8  Length: 351  Mon Nov  7 15:05:54 2016  Type: P  Check: 7600  ..

       1  MSTCDIGGEE RLLILPDECD ASKNINTFTL PPSCNIASKP RLEIFENTDG

      51  KLYEIKCFQF GKGPSYSEEE DLANDKYHYT RENNPIKSAL MVNTSDSADG

     101  YIFKSSKIYF CTLYDIAFSL IGFHYKNSIS ADEQDYVKSS NTDEEQTAER

     151  KEHERFLTLR DYHDLLTDNH DKNWNNISLG SLKCGLAKIS ETIEEAGDVY

     201  YKITPAMITQ YLAGKVAKVI ENFPPSIPTL KHAPVEITQC HKVVIAVNLL

     251  VSLIPKAAYH NLVEFSPTTT DTFFNLHIKA SFTDLEKYET TNELKNAEKE

     301  LLMKSATNIG LGSNGSVSVA MKKVTKKIPQ SNRTRVAIGK GAIDGFFKRK

     351  *

Protein Sequence for WashU_Smik_Contig2790.6:

WashU_Smik_Contig2790.6  Length: 351  Mon Nov  7 15:05:54 2016  Type: P  Check: 602  ..

       1  MTISDIEGEE RIIILPDDYD VSKNINSFTL PPPSNIASKP RIELFEDTNG

      51  KVYEIKSYQF GKGPSYSHEE DLANDKYHYT KENHPIKSTF IVNTSDPADG

     101  YIFKSSKIHF CCLHDVTFSL IGFYYRNSIS EDEQDYVNSN DTSVNQTSNK

     151  KNHERFLTAR DHHDFLTDNH DKNWDNISLS CLRGGLAKIS ETIEEAGEVY

     201  YKITPAMITK YLVEKVSKIA ENFPPSVPIL KHATTEIEQC YKVVVATNLL

     251  VSLIPRAAYH NLVDFSPTMG SYCSDLDIKA SFTSLEDYET KNELKNAEKE

     301  LLMKSAMNVG LNTNSRASLS IKKVTKKVVQ SKKLKVATGK GAIDGFFKRK

     351  *