Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YDR195W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_REF2/YDR195W   1   -MSAPVPQLVNISHALQASTIQQIRLDMVDFNKDCKLSSIQLARIDKYID   49
MIT_Smik_c775_3960   1   -MSAPVPQLVNISHALQASTIQQIRLDMVDFNKDCKLSSIQLARIDKYID   49
MIT_Spar_c118_4479   1   -MSAPVPQLVNISHALQASTIQQIRMDMVDFNKDCKLSSIQLARIDKYID   49
MIT_Suva_c494_4448   1   -MSAPVPQLVNISHALQASTIQQIRLDMVDFNKDCKLSSVQLARIDKYID   49
WashU_Sbay_Contig596.21   1   -MSAPVPQLVNISHALQASTIQQIRLDMVDFNKDCKLSSVQLARIDKYID   49
WashU_Scas_Contig596.13   1   -MSAPIPQLVNISHALQSTTIQQIRADVVDFNSTPFLSQEQFNKIDNYLT   49
WashU_Sklu_Contig1809.3   1   MSSNNIPQMVNISHALQSSTIESMRSDIRDFNQVPELSKEQSDKIDRYIS   50
WashU_Smik_Contig2273.2   1   -MSAPVPQLVNISHALQASTIQQIRLDMVDFNKDCKLSSIQLARIDKYID   49
Symbols






* :**:********::**:.:* *: ***. **. * :**.*:



SGD_Scer_REF2/YDR195W   50   SLQAALNQFTKDNLHIERKEKNVTEADIQLYSGLKSMYLDYLNQLIKLK-   98
MIT_Smik_c775_3960   50   SLQAALNQFTKDNLHIERKDENVTAADVQLYSGLKSMYLDYLNQLIKLK-   98
MIT_Spar_c118_4479   50   SLQAALNQFTNDNLHIERKDKNVTAADVQLYSGLKSMYLDYLNQLIKLK-   98
MIT_Suva_c494_4448   50   SLQAALNQFTRDNLHIERKDEGVTAADVQLYSGLKSMYLDYLNQLIKLK-   98
WashU_Sbay_Contig596.21   50   SLQAALNQFTRDNLHIERKDEGVTAADVQLYSGLKSMYLDYLNQLIKLK-   98
WashU_Scas_Contig596.13   50   SLNLALTQFTNDNQHIQRKEMGVTEADIQLFNGLKSMYSDYLLQLSNLKN   99
WashU_Sklu_Contig1809.3   51   SLETAFAQFAKDNEHIEKKEDNVTVIDIQLYTGLKSMYMDYLSQLTKIK-   99
WashU_Smik_Contig2273.2   50   SLQAALNQYTKDNLHIERKDENVTAADVQLYSGLKSMYLDYLNQLIKLK-   98
Symbols






**: *: *::.** **::*: .** *:**:.****** *** ** ::*



SGD_Scer_REF2/YDR195W   99   --------------------------HEKQHHSTPPIANDVSLDFFVNQL   122
MIT_Smik_c775_3960   99   --------------------------HDKQPHSVPPIANDVSLDFFVNQL   122
MIT_Spar_c118_4479   99   --------------------------HDKQHHSTPPIANDVSLDFFVNQL   122
MIT_Suva_c494_4448   99   --------------------------HDKQHHSAPPIANDVSLDFFVNQL   122
WashU_Sbay_Contig596.21   99   --------------------------HDKQHHSAPPIANDVSLDFFVNQL   122
WashU_Scas_Contig596.13   100   LKIQQLQQHFQQQQQQQQQQQQQISPPAPEPVQKPIDIFEDPPTFINKEF   149
WashU_Sklu_Contig1809.3   100   --------------------------KEKSPKDEE-VGGDQPLEYIINEL   122
WashU_Smik_Contig2273.2   99   --------------------------HDKQPHSVPPIANDVSLDFFVNQL   122
Symbols






. . : . :: :::



SGD_Scer_REF2/YDR195W   123   PKFSPEERKNYIDNLILNKNSHNRLSKMDGLVDAVINLCVLDTSVAENVR   172
MIT_Smik_c775_3960   123   PKFSPEERKNYVDNLILNKNSHNRLSKMDGLVDAVINLCVLDTSVSENVR   172
MIT_Spar_c118_4479   123   PKFSPEERKNYIDNLILNKNSHNRLSKMDGLVDAVINLCVLDTSVAENVR   172
MIT_Suva_c494_4448   123   PKFSIEERKNYIDNLILNKNCHNQLSKMDGLVDAVINLCVLDTSVSENVR   172
WashU_Sbay_Contig596.21   123   PKFSIEERKNYIDNLILNKNCHNQLSKMDGLVDAVINLCVLDTSVSENVR   172
WashU_Scas_Contig596.13   150   NNLKPIQRKNYINAILQDEKLIAKFSKNPILLETIANLCILDSEFSDNIL   199
WashU_Sklu_Contig1809.3   123   PYQQPSERKKYIDALVLSND--RPIEKSDQLLGGIANLSLLDSTISENIR   170
WashU_Smik_Contig2273.2   123   PKFSPEERKNYVDNLILNKNSHNRLSKMDGLVDAVINLCVLDTSVSENVR   172
Symbols






. :**:*:: :: .:. :.* *: : **.:**: .::*:



SGD_Scer_REF2/YDR195W   173   SYMKLLDTLGFQKGSNS-------TGTKANLKKKLASSKAKIKDSEKEKE   215
MIT_Smik_c775_3960   173   SYMKLLDTLGFQKGSNS-------TGTKTKLKKKLTSSKAKVRDSEKDKE   215
MIT_Spar_c118_4479   173   SYMKLLDTLGFQKGSNS-------TGTKVNLKKKLTSSKAKTKDSEKEKE   215
MIT_Suva_c494_4448   173   SYMKLLDTLGFQKGPNS-------ANAKAKLKKKLTSSKAKVKDSEKEKE   215
WashU_Sbay_Contig596.21   173   SYMKLLDTLGFQKGPNS-------ANAKAKLKKKLTSSKAKVKDSEKEKE   215
WashU_Scas_Contig596.13   200   AYITFLKKIGYSDLEIKGNMNRSSSSSGSNSSKEKLTKRSRASSKLKKPS   249
WashU_Sklu_Contig1809.3   171   SYIGFLTKVGYGQDQID-------SIMSHTTSKQYNFQQNLLSPPITKPD   213
WashU_Smik_Contig2273.2   173   SYMKLLDTLGFQKGSNS-------TGTKTKLKKKLTSSKAKVRDSEKDKE   215
Symbols






:*: :* .:*: . . : . .*: .: .. .



SGD_Scer_REF2/YDR195W   216   KE----------KDKSKVKMKTKLKPSPLLNNDDKN---SSPSPTASTSS   252
MIT_Smik_c775_3960   216   ------------KDKLKSKTKIKLKPSPLFSNDDDI---SSSLSSTSSAS   250
MIT_Spar_c118_4479   216   ------------KDKSKVKTKTKLKPSPLLNNDDNN---SLSLPSASTSS   250
MIT_Suva_c494_4448   216   KEKEMDKDRDKDKDKSKTRARTKLKPSPLLNNDDNTSY-SSSLPSASGSS   264
WashU_Sbay_Contig596.21   216   KEKEMDKDRDKDKDKSKTRARTKLKPSPLLNNDDNTSY-SSSLPSASGSS   264
WashU_Scas_Contig596.13   250   TSSTTAKTTTTTAATTATKTATSSKLLKPRTTTTTVKKKKDKLISSSPEK   299
WashU_Sklu_Contig1809.3   214   ------------------------------------------------ET   215
WashU_Smik_Contig2273.2   216   ------------KDKLKSKTKIKLKPSPLLSNDDDI---SSSLSSTSSAS   250
Symbols






.



SGD_Scer_REF2/YDR195W   253   MKKLKSGLFNKNEAKS-TESLPTSS-KKKLSFSKYLNKDDADMTKLGTKR   300
MIT_Smik_c775_3960   251   VKKLKSGLFNKNEDKPSAESLATSS-KKKLSFF-----------------   282
MIT_Spar_c118_4479   251   MKKLKSGLFNKNEVKPSTESSTASS-KKKLSFSKYLNKDDADTAKLGIKR   299
MIT_Suva_c494_4448   265   TKKLKSGLFNKGEAKSSMDAATASSSKKKLSFSKYLNKDDTDTTKSGTKR   314
WashU_Sbay_Contig596.21   265   TKKLKSGLFNKGEAKSSMDAATASSSKKKLSFSKYLNKDDTDTTKSGTKR   314
WashU_Scas_Contig596.13   300   VKKPHIHIATPKMSENSNSTKTESEQKKDATPDDRANNINTNDALSSSQP   349
WashU_Sklu_Contig1809.3   216   PQQYEPNDTDDDSKNATTAIPFEDEPKKKISFSKYLKKGDSNDIPKRPWS   265
WashU_Smik_Contig2273.2   251   VKKLKSGLFNKNEDKPSAESLATSS-KKKLSFSKYLNKDDADSTKLGAKR   299
Symbols






:: . : .. **. :



SGD_Scer_REF2/YDR195W   301   SIDVDFKVNPEASTVASN-IISSS------------TSGSSTTTVATPAS   337
MIT_Smik_c775_3960   
   --------------------------------------------------   
MIT_Spar_c118_4479   300   PLDVDFKVDPEVPMTASN-IASSS------------TSASSTTTIATPAS   336
MIT_Suva_c494_4448   315   SLDSDSKVNPETPTTSTNIASSSS------------SSSSLTTTIVSPAS   352
WashU_Sbay_Contig596.21   315   SLDSDSKVNPETPTTSTNIASSSS------------SSSSLTTTIVSPAS   352
WashU_Scas_Contig596.13   350   KLDSKKKISFSKYLKSDIAVEETSKKRPLPDDEPSDSSSSSFSSSNSTSI   399
WashU_Sklu_Contig1809.3   266   TYDDDYSSAKKARLDTTDSLISIL------------RDDNATS-------   296
WashU_Smik_Contig2273.2   300   TLDLDFKVNPVESTIASNNTASST------------SVSPSTTSEATPVS   337
Symbols










SGD_Scer_REF2/YDR195W   338   SEEPLKKKTKISVQDSNVQSILRNGKPKKARISSIKFLDDSQLIKVYGDD   387
MIT_Smik_c775_3960   
   --------------------------------------------------   
MIT_Spar_c118_4479   337   SEEPLKKKTKKSVRDSNIQSILRNGKPKKTRISNIKFLDDSQLIKVYGDD   386
MIT_Suva_c494_4448   353   SEEPLKKKIKQSVQDPNIRSILRNGKPKKARISNIKFLDDPRLIKVYGDD   402
WashU_Sbay_Contig596.21   353   SEEPLKKKIKQSVQDPNIRSILRNGKPKKARISNIKFLDDPRLIKVYGDD   402
WashU_Scas_Contig596.13   400   QLKKPRSTSDVKVGKSILKKRTTMPTAGKTPTNSIKFISDPKLITVYGDD   449
WashU_Sklu_Contig1809.3   297   ------------------------KKKLKKPRGTIKFVDDSKLVTVYGDD   322
WashU_Smik_Contig2273.2   338   SEEPLKKKTKKSLKDFNVQSILRNGKPKKTRTSNIKFLDDPQLIKVYGDD   387
Symbols










SGD_Scer_REF2/YDR195W   388   LPNQGLQVSPTQLKKILKPFKEGEPKEIILFEDMSIKLKPLDLMFLKNTN   437
MIT_Smik_c775_3960   
   --------------------------------------------------   
MIT_Spar_c118_4479   387   LPNQGLKVSPTQLKKILKPFKEGEPKEVILFEDMSIKLKPLDLKFLKNTN   436
MIT_Suva_c494_4448   403   LPNHGLQVSPIQLKKILKPFKEGEPKEVILFEDMSIKLQPLDLKFLKSTD   452
WashU_Sbay_Contig596.21   403   LPNHGLQVSPIQLKKILKPFKEGEPKEVILFEDMSIKLQPLDLKFLKSTD   452
WashU_Scas_Contig596.13   450   LPNHGLIVSPIELKKILKPFKEGEPNEVLHLENFTSKPIPLQPSLDLTSS   499
WashU_Sklu_Contig1809.3   323   LPKLGLQVSPVQLKKILKPFKEGEPIETLLPAWSNSKAQELHLNTSSVEN   372
WashU_Smik_Contig2273.2   388   LPNQGLQVSPTQLKKILKPFKEGEPKEVILFEDMSIKLKSLDLSFLKNTS   437
Symbols










SGD_Scer_REF2/YDR195W   438   SDDYMDISETKGGPIHCETRTPLIYRKNFNHFNPDLNKRPPREPIEFDLN   487
MIT_Smik_c775_3960   
   --------------------------------------------------   
MIT_Spar_c118_4479   437   SDDYMDISETKGGPIHCETRTPLIYRKNFNHFNPDLNKRPPREPIEFDLN   486
MIT_Suva_c494_4448   453   NGEYMDISETKGGPIHCETRTPLIYRKNFNQFNSDLNKRPPREPIDFDLN   502
WashU_Sbay_Contig596.21   453   NGEYMDISETKGGPIHCETRTPLIYRKNFNQFNSDLNKRPPREPIDFDLN   502
WashU_Scas_Contig596.13   500   PDLYSDIVDIKGGPINCDTNTPMHYRTSFTNFSSSLKQQQPRDPIIVDEE   549
WashU_Sklu_Contig1809.3   373   S----DVTEIRGGPVSCETKVPLTYRLNFTAFSKDLDK-PPKEPVDIDEV   417
WashU_Smik_Contig2273.2   438   NNDYIDISETRGGPIHCETRTPLIYRKNFNHFNSDLNKRPPREPIEFDLN   487
Symbols










SGD_Scer_REF2/YDR195W   488   GN-----------TNSTPTIAKAFGKNSLLLRKDRGGLPYKHVP-IVKRN   525
MIT_Smik_c775_3960   
   --------------------------------------------------   
MIT_Spar_c118_4479   487   GN-----------TNSNPTIAKAFGKNSLLLRKDRGGLPYKHVP-IVKRN   524
MIT_Suva_c494_4448   503   GN-----------ANSSPIIAKAFGKNSLLLRKDRGGLPYKHVP-IVKRN   540
WashU_Sbay_Contig596.21   503   GN-----------ANSSPIIAKAFGKNSLLLRKDRGGLPYKHVP-IVKRN   540
WashU_Scas_Contig596.13   550   DIIEKSKNTMGRKLYRNPIIARAFGENKLLLRKDRGGLPYNNKPPIVVRN   599
WashU_Sklu_Contig1809.3   418   GDNANNK----KRKAKNPLIARAFGRNSLLLKKDRGGMPYKRVP-EINKN   462
WashU_Smik_Contig2273.2   488   GN-----------TNSNPTIAKAFGKNSLLLRKDRGGLPYKHVP-IVKRN   525
Symbols










SGD_Scer_REF2/YDR195W   526   KYPPRPVH   533
MIT_Smik_c775_3960   
   --------   
MIT_Spar_c118_4479   525   KYPPRPVH   532
MIT_Suva_c494_4448   541   KYPPRPVR   548
WashU_Sbay_Contig596.21   541   KYPPRPVR   548
WashU_Scas_Contig596.13   600   NYPIKSSR   607
WashU_Sklu_Contig1809.3   463   TYPLRPLD   470
WashU_Smik_Contig2273.2   526   KYPPRPVR   533
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_REF2/YDR195W:

SGD_Scer_REF2/YDR195W  Length: 534  Mon Nov  7 15:04:09 2016  Type: P  Check: 5059  ..

       1  MSAPVPQLVN ISHALQASTI QQIRLDMVDF NKDCKLSSIQ LARIDKYIDS

      51  LQAALNQFTK DNLHIERKEK NVTEADIQLY SGLKSMYLDY LNQLIKLKHE

     101  KQHHSTPPIA NDVSLDFFVN QLPKFSPEER KNYIDNLILN KNSHNRLSKM

     151  DGLVDAVINL CVLDTSVAEN VRSYMKLLDT LGFQKGSNST GTKANLKKKL

     201  ASSKAKIKDS EKEKEKEKDK SKVKMKTKLK PSPLLNNDDK NSSPSPTAST

     251  SSMKKLKSGL FNKNEAKSTE SLPTSSKKKL SFSKYLNKDD ADMTKLGTKR

     301  SIDVDFKVNP EASTVASNII SSSTSGSSTT TVATPASSEE PLKKKTKISV

     351  QDSNVQSILR NGKPKKARIS SIKFLDDSQL IKVYGDDLPN QGLQVSPTQL

     401  KKILKPFKEG EPKEIILFED MSIKLKPLDL MFLKNTNSDD YMDISETKGG

     451  PIHCETRTPL IYRKNFNHFN PDLNKRPPRE PIEFDLNGNT NSTPTIAKAF

     501  GKNSLLLRKD RGGLPYKHVP IVKRNKYPPR PVH*

Protein Sequence for MIT_Smik_c775_3960:

MIT_Smik_c775_3960  Length: 283  Mon Nov  7 15:04:09 2016  Type: P  Check: 1295  ..

       1  MSAPVPQLVN ISHALQASTI QQIRLDMVDF NKDCKLSSIQ LARIDKYIDS

      51  LQAALNQFTK DNLHIERKDE NVTAADVQLY SGLKSMYLDY LNQLIKLKHD

     101  KQPHSVPPIA NDVSLDFFVN QLPKFSPEER KNYVDNLILN KNSHNRLSKM

     151  DGLVDAVINL CVLDTSVSEN VRSYMKLLDT LGFQKGSNST GTKTKLKKKL

     201  TSSKAKVRDS EKDKEKDKLK SKTKIKLKPS PLFSNDDDIS SSLSSTSSAS

     251  VKKLKSGLFN KNEDKPSAES LATSSKKKLS FF*

Protein Sequence for MIT_Spar_c118_4479:

MIT_Spar_c118_4479  Length: 533  Mon Nov  7 15:04:09 2016  Type: P  Check: 4581  ..

       1  MSAPVPQLVN ISHALQASTI QQIRMDMVDF NKDCKLSSIQ LARIDKYIDS

      51  LQAALNQFTN DNLHIERKDK NVTAADVQLY SGLKSMYLDY LNQLIKLKHD

     101  KQHHSTPPIA NDVSLDFFVN QLPKFSPEER KNYIDNLILN KNSHNRLSKM

     151  DGLVDAVINL CVLDTSVAEN VRSYMKLLDT LGFQKGSNST GTKVNLKKKL

     201  TSSKAKTKDS EKEKEKDKSK VKTKTKLKPS PLLNNDDNNS LSLPSASTSS

     251  MKKLKSGLFN KNEVKPSTES STASSKKKLS FSKYLNKDDA DTAKLGIKRP

     301  LDVDFKVDPE VPMTASNIAS SSTSASSTTT IATPASSEEP LKKKTKKSVR

     351  DSNIQSILRN GKPKKTRISN IKFLDDSQLI KVYGDDLPNQ GLKVSPTQLK

     401  KILKPFKEGE PKEVILFEDM SIKLKPLDLK FLKNTNSDDY MDISETKGGP

     451  IHCETRTPLI YRKNFNHFNP DLNKRPPREP IEFDLNGNTN SNPTIAKAFG

     501  KNSLLLRKDR GGLPYKHVPI VKRNKYPPRP VH*

Protein Sequence for MIT_Suva_c494_4448:

MIT_Suva_c494_4448  Length: 549  Mon Nov  7 15:04:09 2016  Type: P  Check: 5581  ..

       1  MSAPVPQLVN ISHALQASTI QQIRLDMVDF NKDCKLSSVQ LARIDKYIDS

      51  LQAALNQFTR DNLHIERKDE GVTAADVQLY SGLKSMYLDY LNQLIKLKHD

     101  KQHHSAPPIA NDVSLDFFVN QLPKFSIEER KNYIDNLILN KNCHNQLSKM

     151  DGLVDAVINL CVLDTSVSEN VRSYMKLLDT LGFQKGPNSA NAKAKLKKKL

     201  TSSKAKVKDS EKEKEKEKEM DKDRDKDKDK SKTRARTKLK PSPLLNNDDN

     251  TSYSSSLPSA SGSSTKKLKS GLFNKGEAKS SMDAATASSS KKKLSFSKYL

     301  NKDDTDTTKS GTKRSLDSDS KVNPETPTTS TNIASSSSSS SSLTTTIVSP

     351  ASSEEPLKKK IKQSVQDPNI RSILRNGKPK KARISNIKFL DDPRLIKVYG

     401  DDLPNHGLQV SPIQLKKILK PFKEGEPKEV ILFEDMSIKL QPLDLKFLKS

     451  TDNGEYMDIS ETKGGPIHCE TRTPLIYRKN FNQFNSDLNK RPPREPIDFD

     501  LNGNANSSPI IAKAFGKNSL LLRKDRGGLP YKHVPIVKRN KYPPRPVR*


Protein Sequence for WashU_Sbay_Contig596.21:

WashU_Sbay_Contig596.21  Length: 549  Mon Nov  7 15:04:09 2016  Type: P  Check: 5581  ..

       1  MSAPVPQLVN ISHALQASTI QQIRLDMVDF NKDCKLSSVQ LARIDKYIDS

      51  LQAALNQFTR DNLHIERKDE GVTAADVQLY SGLKSMYLDY LNQLIKLKHD

     101  KQHHSAPPIA NDVSLDFFVN QLPKFSIEER KNYIDNLILN KNCHNQLSKM

     151  DGLVDAVINL CVLDTSVSEN VRSYMKLLDT LGFQKGPNSA NAKAKLKKKL

     201  TSSKAKVKDS EKEKEKEKEM DKDRDKDKDK SKTRARTKLK PSPLLNNDDN

     251  TSYSSSLPSA SGSSTKKLKS GLFNKGEAKS SMDAATASSS KKKLSFSKYL

     301  NKDDTDTTKS GTKRSLDSDS KVNPETPTTS TNIASSSSSS SSLTTTIVSP

     351  ASSEEPLKKK IKQSVQDPNI RSILRNGKPK KARISNIKFL DDPRLIKVYG

     401  DDLPNHGLQV SPIQLKKILK PFKEGEPKEV ILFEDMSIKL QPLDLKFLKS

     451  TDNGEYMDIS ETKGGPIHCE TRTPLIYRKN FNQFNSDLNK RPPREPIDFD

     501  LNGNANSSPI IAKAFGKNSL LLRKDRGGLP YKHVPIVKRN KYPPRPVR*


Protein Sequence for WashU_Scas_Contig596.13:

WashU_Scas_Contig596.13  Length: 608  Mon Nov  7 15:04:09 2016  Type: P  Check: 1283  ..

       1  MSAPIPQLVN ISHALQSTTI QQIRADVVDF NSTPFLSQEQ FNKIDNYLTS

      51  LNLALTQFTN DNQHIQRKEM GVTEADIQLF NGLKSMYSDY LLQLSNLKNL

     101  KIQQLQQHFQ QQQQQQQQQQ QQISPPAPEP VQKPIDIFED PPTFINKEFN

     151  NLKPIQRKNY INAILQDEKL IAKFSKNPIL LETIANLCIL DSEFSDNILA

     201  YITFLKKIGY SDLEIKGNMN RSSSSSGSNS SKEKLTKRSR ASSKLKKPST

     251  SSTTAKTTTT TAATTATKTA TSSKLLKPRT TTTTVKKKKD KLISSSPEKV

     301  KKPHIHIATP KMSENSNSTK TESEQKKDAT PDDRANNINT NDALSSSQPK

     351  LDSKKKISFS KYLKSDIAVE ETSKKRPLPD DEPSDSSSSS FSSSNSTSIQ

     401  LKKPRSTSDV KVGKSILKKR TTMPTAGKTP TNSIKFISDP KLITVYGDDL

     451  PNHGLIVSPI ELKKILKPFK EGEPNEVLHL ENFTSKPIPL QPSLDLTSSP

     501  DLYSDIVDIK GGPINCDTNT PMHYRTSFTN FSSSLKQQQP RDPIIVDEED

     551  IIEKSKNTMG RKLYRNPIIA RAFGENKLLL RKDRGGLPYN NKPPIVVRNN

     601  YPIKSSR*

Protein Sequence for WashU_Sklu_Contig1809.3:

WashU_Sklu_Contig1809.3  Length: 471  Mon Nov  7 15:04:09 2016  Type: P  Check: 3769  ..

       1  MSSNNIPQMV NISHALQSST IESMRSDIRD FNQVPELSKE QSDKIDRYIS

      51  SLETAFAQFA KDNEHIEKKE DNVTVIDIQL YTGLKSMYMD YLSQLTKIKK

     101  EKSPKDEEVG GDQPLEYIIN ELPYQQPSER KKYIDALVLS NDRPIEKSDQ

     151  LLGGIANLSL LDSTISENIR SYIGFLTKVG YGQDQIDSIM SHTTSKQYNF

     201  QQNLLSPPIT KPDETPQQYE PNDTDDDSKN ATTAIPFEDE PKKKISFSKY

     251  LKKGDSNDIP KRPWSTYDDD YSSAKKARLD TTDSLISILR DDNATSKKKL

     301  KKPRGTIKFV DDSKLVTVYG DDLPKLGLQV SPVQLKKILK PFKEGEPIET

     351  LLPAWSNSKA QELHLNTSSV ENSDVTEIRG GPVSCETKVP LTYRLNFTAF

     401  SKDLDKPPKE PVDIDEVGDN ANNKKRKAKN PLIARAFGRN SLLLKKDRGG

     451  MPYKRVPEIN KNTYPLRPLD *

Protein Sequence for WashU_Smik_Contig2273.2:

WashU_Smik_Contig2273.2  Length: 534  Mon Nov  7 15:04:09 2016  Type: P  Check: 8812  ..

       1  MSAPVPQLVN ISHALQASTI QQIRLDMVDF NKDCKLSSIQ LARIDKYIDS

      51  LQAALNQYTK DNLHIERKDE NVTAADVQLY SGLKSMYLDY LNQLIKLKHD

     101  KQPHSVPPIA NDVSLDFFVN QLPKFSPEER KNYVDNLILN KNSHNRLSKM

     151  DGLVDAVINL CVLDTSVSEN VRSYMKLLDT LGFQKGSNST GTKTKLKKKL

     201  TSSKAKVRDS EKDKEKDKLK SKTKIKLKPS PLLSNDDDIS SSLSSTSSAS

     251  VKKLKSGLFN KNEDKPSAES LATSSKKKLS FSKYLNKDDA DSTKLGAKRT

     301  LDLDFKVNPV ESTIASNNTA SSTSVSPSTT SEATPVSSEE PLKKKTKKSL

     351  KDFNVQSILR NGKPKKTRTS NIKFLDDPQL IKVYGDDLPN QGLQVSPTQL

     401  KKILKPFKEG EPKEVILFED MSIKLKSLDL SFLKNTSNND YIDISETRGG

     451  PIHCETRTPL IYRKNFNHFN SDLNKRPPRE PIEFDLNGNT NSNPTIAKAF

     501  GKNSLLLRKD RGGLPYKHVP IVKRNKYPPR PVR*