Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YDR158W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_HOM2/YDR158W   1   --------------MAGKKIAGVLGATGSVGQRFILLLANHPHFELKVLG   36
MIT_Smik_c760_3805   1   --------------MAGKKIAGVLGATGSVGQRFILLLADHPHFELKVLG   36
MIT_Spar_c119_4320   1   --------------MAGKKVAGVLGATGSVGQRFILLLADHPHFELKVLG   36
MIT_Suva_c473_4089   1   --------------MAGKKIAGVLGATGSVGQRFILLLADHPHFELKVLG   36
WashU_Sbay_Contig450.3   1   --------------MAGKKIAGVLGATGSVGQRFILLLADHPHFELKVLG   36
WashU_Scas_Contig682.32   1   MNKAKLNNKSHNIMVAQKKIAGVLGATGSVGQRFILLLAEHPSFELRVLG   50
WashU_Sklu_Contig2396.8   1   --------------MSQKKIAGVLGATGSVGQRFILLLANHPDFELKVLG   36
Symbols






:: **:*******************:** ***:***



SGD_Scer_HOM2/YDR158W   37   ASSRSAGKKYVDAVNWKQTDLLPESATDIIVSECKSEFFKECDIVFSGLD   86
MIT_Smik_c760_3805   37   ASSRSAGKKYVDAVNWKQTDLLPESATDIVVSECKSEYFKECDIVFSGLD   86
MIT_Spar_c119_4320   37   ASSRSAGKKYVDAVNWKQTDLLPESATDIVVSECKSEFFKECDIVFSGLD   86
MIT_Suva_c473_4089   37   ASSRSAGKKYIDAVNWKQTDLLPESANDIVVSECKSEFFKDCDIVFSGLD   86
WashU_Sbay_Contig450.3   37   ASSRSAGKKYIDAVNWKQTDLLPESANDIVVSECKSEFFKDCDIVFSGLD   86
WashU_Scas_Contig682.32   51   ASPRSAGKKYIDAVNWKQTDLLPTMAEDIIVTECKSEFFKDCDIVFSGLD   100
WashU_Sklu_Contig2396.8   37   ASPRSAGKKYIDAVNWKQTDLLPEFAKDIIVTECTSDAFKQCDVVFSGLD   86
Symbols






**.*******:************ * **:*:**.*: **:**:******



SGD_Scer_HOM2/YDR158W   87   ADYAGAIEKEFMEAGIAIVSNAKNYRREQDVPLIVPVVNPEHLDIVAQKL   136
MIT_Smik_c760_3805   87   ADYAGAIEKEFMEAGIAIVSNAKNYRREQDVPLIVPVVNPEHLDIVAQKL   136
MIT_Spar_c119_4320   87   ADYAGAIEKEFMEAGIAIVSNAKNYRREQDVPLIVPVVNPEHLDIVAQKL   136
MIT_Suva_c473_4089   87   ADYAGSIEKEFMEAGIPIVSNAKNYRREQDVPLIVPVVNPEHLDIVAQKL   136
WashU_Sbay_Contig450.3   87   ADYAGSIEKEFMEAGIPIVSNAKNYRREQDVPLIVPVVNPEHLDIVAQKL   136
WashU_Scas_Contig682.32   101   ADYAGAIEKEFVEAGLAVVSNAKNYRREEDVPLLVPIVNPEHLDIVSNKL   150
WashU_Sklu_Contig2396.8   87   ADYAGPIEKEFVEAGLAVISNAKNYRREADVPLVVPIVNPEHMDMIATKL   136
Symbols






*****.*****:***:.::********* ****:**:*****:*::: **



SGD_Scer_HOM2/YDR158W   137   DTAKAQGKPRPGFIICISNCSTAGLVAPLKPLIEKFGPIDALTTTTLQAI   186
MIT_Smik_c760_3805   137   ETAKAQGKSRPGFIICISNCSTAGLVAPLKPLVEKFGPIDALTTATLQAI   186
MIT_Spar_c119_4320   137   ETAKVQGKPRPGFIICISNCSTAGLVAPLKPLIEKFGPIDALTTTTLQAI   186
MIT_Suva_c473_4089   137   ETAKAQGKPRPGFIICISNCSTAGLVAPLKPLIEKFGPIDALTTTTLQAI   186
WashU_Sbay_Contig450.3   137   ETAKAQGKPRPGFIICISNCSTAGLVAPLKPLIEKFGPIDALTTTTLQAI   186
WashU_Scas_Contig682.32   151   EKAKSEGKSKPGFIVCISNCSTAGLVAPLKPLVEKFGPIDALTTTTLQAI   200
WashU_Sklu_Contig2396.8   137   ENAKAAGVSKPGFIVCISNCSTAGLVAPLKPLVEKFGPIDALTTTTLQAI   186
Symbols






:.** * .:****:*****************:***********:*****



SGD_Scer_HOM2/YDR158W   187   SGAGFSPGVPGIDILDNIIPYIGGEEDKMEWETKKILAPLAEDKTHVKLL   236
MIT_Smik_c760_3805   187   SGAGFSPGVPGIDILDNIIPYIGGEEDKMEWETKKILAPLSEDRTHVKLL   236
MIT_Spar_c119_4320   187   SGAGFSPGVPGIDILDNIIPYIGGEEDKMEWETKKILAPLAEDKTHVKLL   236
MIT_Suva_c473_4089   187   SGAGFSPGVPGIDILDNIIPYIGGEEDKMEWETKKILAPLSEDKTQVKLL   236
WashU_Sbay_Contig450.3   187   SGAGFSPGVPGIDILDNIIPYIGGEEDKMEWETKKILAPLSEDKTQVKLL   236
WashU_Scas_Contig682.32   201   SGAGFSPGVPGIDILDNIIPYIGGEEDKMEWETKKILGSIAEDKTHIKLL   250
WashU_Sklu_Contig2396.8   187   SGAGFSPGVPGIDILDNIIPYIGGEEDKMEWETKKILGSLNQDNSSVQLL   236
Symbols






*************************************..: :*.: ::**



SGD_Scer_HOM2/YDR158W   237   TPEEIKVSAQCNRVAVSDGHTECISLRFKNRPAPSVEQVKTCLKEYVCDA   286
MIT_Smik_c760_3805   237   TSEEIKVSAQCNRVAVSDGHTECISLRFKNRPAPSVEQVKTCLKEYVCDA   286
MIT_Spar_c119_4320   237   TPEEIKVSAQCNRVAVSDGHTECISLRFKNRPAPSVEQVKTCLKEYVCDA   286
MIT_Suva_c473_4089   237   TPEEIKVSAQCNRVAVSDGHTECISLRFKNRPAPSVEQVKTCLREYVCDA   286
WashU_Sbay_Contig450.3   237   TPEEIKVSAQCNRVAVSDGHTECISLRFKNRPAPSVEQVKTCLREYVCDA   286
WashU_Scas_Contig682.32   251   TPEEIKVSAQCNRVAVSDGHTECISLRFKNRPAPSVDAVKQCLRDYVCDA   300
WashU_Sklu_Contig2396.8   237   SDDEIKVSAQCNRVAVSDGHTECISLRFKNQPAPSVEEVKQCLRDYVCDA   286
Symbols






: :***************************:*****: ** **::*****



SGD_Scer_HOM2/YDR158W   287   YKLGCHSAPKQTIHVLEQPDRPQPRLDRNRDSGYGVSVGRIREDPLLDFK   336
MIT_Smik_c760_3805   287   YKLGCHSAPKQTIHVLEQPDRPQPRLDRNRDSGYGVSVGRIREDPLLDFK   336
MIT_Spar_c119_4320   287   YKLGCHSAPKQTIHVLEQPDRPQPRLDRNRDSGYGVSVGRIREDPLLDFK   336
MIT_Suva_c473_4089   287   YKLGCHSAPKQTIHVLDQADRPQPRLDRNRDNGYGVSVGRIREDPLLDFK   336
WashU_Sbay_Contig450.3   287   YKLGCHSAPKQTIHVLDQADRPQPRLDRNRDNGYGVSVGRIREDPLLDFK   336
WashU_Scas_Contig682.32   301   FKLGCHSAPKQTIHVLEQNDRPQPRLDRNRDAGYGVSVGRIREDPVLDFK   350
WashU_Sklu_Contig2396.8   287   TKLGCHSAPEQTIHVLEQSDRPQPRLDRNRDNGYGVSVGRIREDPVLDFK   336
Symbols






********:******:* ************ *************:****



SGD_Scer_HOM2/YDR158W   337   MVVLSHNTIIGAAGSGVLIAEILLARNLI   365
MIT_Smik_c760_3805   337   MVVLSHNTIIGAAGSGVLIAEILLARNLI   365
MIT_Spar_c119_4320   337   MVVLSHNTIIGAAGSGVLIAEILLARNLI   365
MIT_Suva_c473_4089   337   MVVLSHNTIIGAAGSGVLIAEILLARNLI   365
WashU_Sbay_Contig450.3   337   MVVLSHNTIIGAAGSGVLIAEILLARNLI   365
WashU_Scas_Contig682.32   351   MVVLSHNTIIGAAGAGVLIAEILLARNMI   379
WashU_Sklu_Contig2396.8   337   MVVLSHNTVIGAAGAGILIAEILLARNLI   365
Symbols






********:*****:*:**********:*



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_HOM2/YDR158W:

SGD_Scer_HOM2/YDR158W  Length: 366  Mon Nov  7 15:03:15 2016  Type: P  Check: 1168  ..

       1  MAGKKIAGVL GATGSVGQRF ILLLANHPHF ELKVLGASSR SAGKKYVDAV

      51  NWKQTDLLPE SATDIIVSEC KSEFFKECDI VFSGLDADYA GAIEKEFMEA

     101  GIAIVSNAKN YRREQDVPLI VPVVNPEHLD IVAQKLDTAK AQGKPRPGFI

     151  ICISNCSTAG LVAPLKPLIE KFGPIDALTT TTLQAISGAG FSPGVPGIDI

     201  LDNIIPYIGG EEDKMEWETK KILAPLAEDK THVKLLTPEE IKVSAQCNRV

     251  AVSDGHTECI SLRFKNRPAP SVEQVKTCLK EYVCDAYKLG CHSAPKQTIH

     301  VLEQPDRPQP RLDRNRDSGY GVSVGRIRED PLLDFKMVVL SHNTIIGAAG

     351  SGVLIAEILL ARNLI*

Protein Sequence for MIT_Smik_c760_3805:

MIT_Smik_c760_3805  Length: 366  Mon Nov  7 15:03:15 2016  Type: P  Check: 3041  ..

       1  MAGKKIAGVL GATGSVGQRF ILLLADHPHF ELKVLGASSR SAGKKYVDAV

      51  NWKQTDLLPE SATDIVVSEC KSEYFKECDI VFSGLDADYA GAIEKEFMEA

     101  GIAIVSNAKN YRREQDVPLI VPVVNPEHLD IVAQKLETAK AQGKSRPGFI

     151  ICISNCSTAG LVAPLKPLVE KFGPIDALTT ATLQAISGAG FSPGVPGIDI

     201  LDNIIPYIGG EEDKMEWETK KILAPLSEDR THVKLLTSEE IKVSAQCNRV

     251  AVSDGHTECI SLRFKNRPAP SVEQVKTCLK EYVCDAYKLG CHSAPKQTIH

     301  VLEQPDRPQP RLDRNRDSGY GVSVGRIRED PLLDFKMVVL SHNTIIGAAG

     351  SGVLIAEILL ARNLI*

Protein Sequence for MIT_Spar_c119_4320:

MIT_Spar_c119_4320  Length: 366  Mon Nov  7 15:03:15 2016  Type: P  Check: 1693  ..

       1  MAGKKVAGVL GATGSVGQRF ILLLADHPHF ELKVLGASSR SAGKKYVDAV

      51  NWKQTDLLPE SATDIVVSEC KSEFFKECDI VFSGLDADYA GAIEKEFMEA

     101  GIAIVSNAKN YRREQDVPLI VPVVNPEHLD IVAQKLETAK VQGKPRPGFI

     151  ICISNCSTAG LVAPLKPLIE KFGPIDALTT TTLQAISGAG FSPGVPGIDI

     201  LDNIIPYIGG EEDKMEWETK KILAPLAEDK THVKLLTPEE IKVSAQCNRV

     251  AVSDGHTECI SLRFKNRPAP SVEQVKTCLK EYVCDAYKLG CHSAPKQTIH

     301  VLEQPDRPQP RLDRNRDSGY GVSVGRIRED PLLDFKMVVL SHNTIIGAAG

     351  SGVLIAEILL ARNLI*

Protein Sequence for MIT_Suva_c473_4089:

MIT_Suva_c473_4089  Length: 366  Mon Nov  7 15:03:15 2016  Type: P  Check: 2626  ..

       1  MAGKKIAGVL GATGSVGQRF ILLLADHPHF ELKVLGASSR SAGKKYIDAV

      51  NWKQTDLLPE SANDIVVSEC KSEFFKDCDI VFSGLDADYA GSIEKEFMEA

     101  GIPIVSNAKN YRREQDVPLI VPVVNPEHLD IVAQKLETAK AQGKPRPGFI

     151  ICISNCSTAG LVAPLKPLIE KFGPIDALTT TTLQAISGAG FSPGVPGIDI

     201  LDNIIPYIGG EEDKMEWETK KILAPLSEDK TQVKLLTPEE IKVSAQCNRV

     251  AVSDGHTECI SLRFKNRPAP SVEQVKTCLR EYVCDAYKLG CHSAPKQTIH

     301  VLDQADRPQP RLDRNRDNGY GVSVGRIRED PLLDFKMVVL SHNTIIGAAG

     351  SGVLIAEILL ARNLI*

Protein Sequence for WashU_Sbay_Contig450.3:

WashU_Sbay_Contig450.3  Length: 366  Mon Nov  7 15:03:15 2016  Type: P  Check: 2626  ..

       1  MAGKKIAGVL GATGSVGQRF ILLLADHPHF ELKVLGASSR SAGKKYIDAV

      51  NWKQTDLLPE SANDIVVSEC KSEFFKDCDI VFSGLDADYA GSIEKEFMEA

     101  GIPIVSNAKN YRREQDVPLI VPVVNPEHLD IVAQKLETAK AQGKPRPGFI

     151  ICISNCSTAG LVAPLKPLIE KFGPIDALTT TTLQAISGAG FSPGVPGIDI

     201  LDNIIPYIGG EEDKMEWETK KILAPLSEDK TQVKLLTPEE IKVSAQCNRV

     251  AVSDGHTECI SLRFKNRPAP SVEQVKTCLR EYVCDAYKLG CHSAPKQTIH

     301  VLDQADRPQP RLDRNRDNGY GVSVGRIRED PLLDFKMVVL SHNTIIGAAG

     351  SGVLIAEILL ARNLI*

Protein Sequence for WashU_Scas_Contig682.32:

WashU_Scas_Contig682.32  Length: 380  Mon Nov  7 15:03:15 2016  Type: P  Check: 666  ..

       1  MNKAKLNNKS HNIMVAQKKI AGVLGATGSV GQRFILLLAE HPSFELRVLG

      51  ASPRSAGKKY IDAVNWKQTD LLPTMAEDII VTECKSEFFK DCDIVFSGLD

     101  ADYAGAIEKE FVEAGLAVVS NAKNYRREED VPLLVPIVNP EHLDIVSNKL

     151  EKAKSEGKSK PGFIVCISNC STAGLVAPLK PLVEKFGPID ALTTTTLQAI

     201  SGAGFSPGVP GIDILDNIIP YIGGEEDKME WETKKILGSI AEDKTHIKLL

     251  TPEEIKVSAQ CNRVAVSDGH TECISLRFKN RPAPSVDAVK QCLRDYVCDA

     301  FKLGCHSAPK QTIHVLEQND RPQPRLDRNR DAGYGVSVGR IREDPVLDFK

     351  MVVLSHNTII GAAGAGVLIA EILLARNMI*

Protein Sequence for WashU_Sklu_Contig2396.8:

WashU_Sklu_Contig2396.8  Length: 366  Mon Nov  7 15:03:15 2016  Type: P  Check: 3986  ..

       1  MSQKKIAGVL GATGSVGQRF ILLLANHPDF ELKVLGASPR SAGKKYIDAV

      51  NWKQTDLLPE FAKDIIVTEC TSDAFKQCDV VFSGLDADYA GPIEKEFVEA

     101  GLAVISNAKN YRREADVPLV VPIVNPEHMD MIATKLENAK AAGVSKPGFI

     151  VCISNCSTAG LVAPLKPLVE KFGPIDALTT TTLQAISGAG FSPGVPGIDI

     201  LDNIIPYIGG EEDKMEWETK KILGSLNQDN SSVQLLSDDE IKVSAQCNRV

     251  AVSDGHTECI SLRFKNQPAP SVEEVKQCLR DYVCDATKLG CHSAPEQTIH

     301  VLEQSDRPQP RLDRNRDNGY GVSVGRIRED PVLDFKMVVL SHNTVIGAAG

     351  AGILIAEILL ARNLI*