Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YDL229W and Homologs


Choose two or more sequences for alignment:
Pick a sequence type:
Best Hits & Orthologs"Other" Hits

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_SSB1/YDL229W   1   MAEGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVAFTPEE   50
MIT_Smik_c196_2387   1   MAEGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVAFTPEE   50
MIT_Spar_c429_2913   1   MAEGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVAFTPEE   50
WashU_Sbay_Contig538.4   1   MAEGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVAFTPEE   50
WashU_Skud_Contig1629.3   1   MAEGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVAFTPEE   50
WashU_Smik_Contig2755.3   1   MAEGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVAFTPEE   50
Symbols






**************************************************



SGD_Scer_SSB1/YDL229W   51   RLIGDAAKNQAALNPRNTVFDAKRLIGRRFDDESVQKDMKTWPFKVIDVD   100
MIT_Smik_c196_2387   51   RLIGDAAKNQAALNPRNTVFDAKRLIGRRFDDESVQKDMKTWPFKVIDVD   100
MIT_Spar_c429_2913   51   RLIGDAAKNQAALNPRNTVFDAKRLIGRRFDDESVQKDMKTWPFKVIDVD   100
WashU_Sbay_Contig538.4   51   RLIGDAAKNQAALNPRNTVFDAKRLIGRRFDDESVQKDMKTWPFKVIDVE   100
WashU_Skud_Contig1629.3   51   RLIGDAAKNQAALNPRNTVFDAKRLIGRRFDDESVQKDMKTWPFKVIDVD   100
WashU_Smik_Contig2755.3   51   RLIGDAAKNQAALNPRNTVFDAKRLIGRRFDDESVQKDMKTWPFKVIDVD   100
Symbols






*************************************************:



SGD_Scer_SSB1/YDL229W   101   GNPVIEVQYLEETKTFSPQEISAMVLTKMKEIAEAKIGKKVEKAVITVPA   150
MIT_Smik_c196_2387   101   GNPVIEVQYLEETKTFSPQEISAMVLTKMKEIAEAKIGKKVEKAVITVPA   150
MIT_Spar_c429_2913   101   GNPVIEVQYLEETKTFSPQEISAMVLTKMKEIAEAKIGKKVEKAVITVPA   150
WashU_Sbay_Contig538.4   101   GNPVIEVQYLEETKTFSPQEISAMVLTKMKEIAEAKIGKKVEKAVITVPA   150
WashU_Skud_Contig1629.3   101   GNPVIEVQYLDETKTFSPQEISAMVLTKMKEIAEAKIGKKVEKAVITVPA   150
WashU_Smik_Contig2755.3   101   GNPVIEVQYLEETKTFSPQEISAMVLTKMKEIAEAKIGKKVEKAVITVPA   150
Symbols






**********:***************************************



SGD_Scer_SSB1/YDL229W   151   YFNDAQRQATKDAGAISGLNVLRIINEPTAAAIAYGLGAGKSEKERHVLI   200
MIT_Smik_c196_2387   151   YFNDAQRQATKDAGAISGLNVLRIINEPTAAAIAYGLGAGKSEKERHVLI   200
MIT_Spar_c429_2913   151   YFNDAQRQATKDAGAISGLNVLRIINEPTAAAIAYGLGAGKSEKERHVLI   200
WashU_Sbay_Contig538.4   151   YFNDAQRQATKDAGSISGLNVLRIINEPTAAAIAYGLGAGKSEKERHVMI   200
WashU_Skud_Contig1629.3   151   YFNDAQRQATKDAGAISGLNVLRIINEPTAAAIAYGLGAGKSEKERHVLI   200
WashU_Smik_Contig2755.3   151   YFNDAQRQATKDAGAISGLNVLRIINEPTAAAIAYGLGAGKSEKERHVLI   200
Symbols






**************:*********************************:*



SGD_Scer_SSB1/YDL229W   201   FDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNLLEHFKAEFKK   250
MIT_Smik_c196_2387   201   FDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNLLEHFKAEFKK   250
MIT_Spar_c429_2913   201   FDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNLLEHFKAEFKK   250
WashU_Sbay_Contig538.4   201   FDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNLLEHFKAEFKK   250
WashU_Skud_Contig1629.3   201   FDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNLLEHFKAEFKK   250
WashU_Smik_Contig2755.3   201   FDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNLLEHFKAEFKK   250
Symbols






**************************************************



SGD_Scer_SSB1/YDL229W   251   KTGLDISDDARALRRLRTAAERAKRTLSSVTQTTVEVDSLFDGEDFESSL   300
MIT_Smik_c196_2387   251   KTGLDISDDARALRRLRTAAERAKRTLSSVTQTTVEVDSLFDGEDFESSL   300
MIT_Spar_c429_2913   251   KTGLDISDDARALRRLRTAAERAKRTLSSVTQTTVEVDSLFDGEDFESSL   300
WashU_Sbay_Contig538.4   251   KTGLDISEDARALRRLRTAAERAKRTLSSVTQTTVEVDSLFDGEDFESSL   300
WashU_Skud_Contig1629.3   251   KTGLDISDDARALRRLRTAAERAKRTLSSVTQTTVEVDSLFDGEDFESSL   300
WashU_Smik_Contig2755.3   251   KTGLDISDDARALRRLRTAAERAKRTLSSVTQTTVEVDSLFDGEDFESSL   300
Symbols






*******:******************************************



SGD_Scer_SSB1/YDL229W   301   TRARFEDLNAALFKSTLEPVEQVLKDAKISKSQIDEVVLVGGSTRIPKVQ   350
MIT_Smik_c196_2387   301   TRARFEDLNAPLFKSTLEPVEQVLKDAKISKSQIDEVVLVGGSTRIPKVQ   350
MIT_Spar_c429_2913   301   TRARFEDLNAPLFKSTLEPVEQVLKDAKISKSQIDEVVLVGGSTRIPKVQ   350
WashU_Sbay_Contig538.4   301   TRARFEDLNAPMFKSTLEPVEQVLKDAKISKSQIDEVVLVGGSTRIPKVQ   350
WashU_Skud_Contig1629.3   301   TRARFEDLNAPLFKSTLEPVEQVLKDAKTSKSQIDEVVLVGGSTRIPKVQ   350
WashU_Smik_Contig2755.3   301   TRARFEDLNAPLFKSTLEPVEQVLKDAKISKSQIDEVVLVGGSTRIPKVQ   350
Symbols






**********.:**************** *********************



SGD_Scer_SSB1/YDL229W   351   KLLSDFFDGKQLEKSINPDEAVAYGAAVQGAILTGQSTSDETKDLLLLDV   400
MIT_Smik_c196_2387   351   KLLSDFFDGKQLEKSINPDEAVAYGAAVQGAILTGQSTSDETKDLLLLDV   400
MIT_Spar_c429_2913   351   KLLSDFFDGKQLEKSINPDEAVAYGAAVQGAILTGQSTSDETKDLLLLDV   400
WashU_Sbay_Contig538.4   351   KLLSDFFDGKQLEKSINPDEAVAYGAAVQGAILTGQSTSDETKDLLLLDV   400
WashU_Skud_Contig1629.3   351   KLLSDFFDGKQLEKSINPDEAVAYGAAVQGAILTGQSTSEETKDLLLLDV   400
WashU_Smik_Contig2755.3   351   KLLSDFFDGKQLEKSINPDEAVAYGAAVQGAILTGQSTSDETKDLLLLDV   400
Symbols






***************************************:**********



SGD_Scer_SSB1/YDL229W   401   APLSLGVGMQGDMFGIVVPRNTTVPTIKRRTFTTCADNQTTVQFPVYQGE   450
MIT_Smik_c196_2387   401   APLSLGVGMQGDMFGIVVPRNTTVPTIKRRTFTTCADNQTTVQFPVYQGE   450
MIT_Spar_c429_2913   401   APLSLGVGMQGDMFGIVVPRNTTVPTIKRRTFTTCADNQTTVQFPVYQGE   450
WashU_Sbay_Contig538.4   401   APLSLGVGMQGDMFGIVVPRNTTVPTIKRRTFTTCGDNQTTVQFPVYQGE   450
WashU_Skud_Contig1629.3   401   APLSLGVGMQGDIFGIVVPRNTTVPTIKRRTFTTCADNQTTVQFPVYQGE   450
WashU_Smik_Contig2755.3   401   APLSLGVGMQGDMFGIVVPRNTTVPTIKRRTFTTCADNQTTVQFPVYQGE   450
Symbols






************:**********************.**************



SGD_Scer_SSB1/YDL229W   451   RVNCKENTLLGEFDLKNIPMMPAGEPVLEAIFEVDANGILKVTAVEKSTG   500
MIT_Smik_c196_2387   451   RVNCKENTLLGEFDLKNIPMMPAGEPVLEAIFEVDANGILKVTAVEKSTG   500
MIT_Spar_c429_2913   451   RVNCKENTLLGEFDLKNIPMMPAGEPVLEAIFEVDANGILKVTAVEKSTG   500
WashU_Sbay_Contig538.4   451   RVNCKENTLLGEFDLRGIPMMPAGEPVLEAIFEVDANGILKVTAVEKSTG   500
WashU_Skud_Contig1629.3   451   RVNCKENTLLGEFDLRNIPMMPAGEPVLEAIFEVDANGILKVTAVEKSTG   500
WashU_Smik_Contig2755.3   451   RVNCKENTLLGEFDLKNIPMMPAGEPVLEAIFEVDANGILKVTAVEKSTG   500
Symbols






***************:.*********************************



SGD_Scer_SSB1/YDL229W   501   KSSNITISNAVGRLSSEEIEKMVNQAEEFKAADEAFAKKHEARQRLESYV   550
MIT_Smik_c196_2387   501   KSSNITISNAVGRLSSEEIEKMVNQAEEFKAADEAFAKKHEARQRLESYV   550
MIT_Spar_c429_2913   501   KSSNITISNAVGRLSSEEIEKMVNQAEEFKAADEAFAKKHEARQRLESYV   550
WashU_Sbay_Contig538.4   501   KSSNITISNAVGRLSSDEIEKMVNQAEEFKAADEAFAKKHEARQRLESYV   550
WashU_Skud_Contig1629.3   501   KSSNITISNAVGRLSSDEIEKMVNQAEEFKAADEAFAKKHEARQRLESYV   550
WashU_Smik_Contig2755.3   501   KSSNITISNAVGRLSSEEIEKMVNQAEEFKAADEAFAKKHEARQRLESYV   550
Symbols






****************:*********************************



SGD_Scer_SSB1/YDL229W   551   ASIEQTVTDPVLSSKLKRGSKSKIEAALSDALAALQIEDPSADELRKAEV   600
MIT_Smik_c196_2387   551   ASIEQTVTDPVLSSKLKRGSKSKIEAALSDALAALQIEDPSADELRKAEV   600
MIT_Spar_c429_2913   551   ASIEQTVTDPVLSSKLKRGSKSKIEAALSDALAALQIEDPSADELRKAEV   600
WashU_Sbay_Contig538.4   551   ASIEQNVTDPILSSKLKRGSKSKIEAALSDAMAALQIEDASTDELRKAEV   600
WashU_Skud_Contig1629.3   551   ASIEQTVTDPVLSSKLKRGSKSKIEAALSDALAALQIEDPSTDELRKAEV   600
WashU_Smik_Contig2755.3   551   ASIEQTVTDPVLSSKLKRGSKSKIEAALSDALAALQIEDPSADELRKAEV   600
Symbols






*****.****:********************:*******.*:********



SGD_Scer_SSB1/YDL229W   601   GLKRVVTKAMSSR   613
MIT_Smik_c196_2387   601   GLKRVVTKAMSSR   613
MIT_Spar_c429_2913   601   GLKRVVTKAMSSR   613
WashU_Sbay_Contig538.4   601   GLKRVVTKAMSSR   613
WashU_Skud_Contig1629.3   601   GLKRVVTKAMSSR   613
WashU_Smik_Contig2755.3   601   GLKRVVTKAMSSR   613
Symbols






*************



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_SSB1/YDL229W:

SGD_Scer_SSB1/YDL229W  Length: 614  Mon Nov  7 14:59:37 2016  Type: P  Check: 4263  ..

       1  MAEGVFQGAI GIDLGTTYSC VATYESSVEI IANEQGNRVT PSFVAFTPEE

      51  RLIGDAAKNQ AALNPRNTVF DAKRLIGRRF DDESVQKDMK TWPFKVIDVD

     101  GNPVIEVQYL EETKTFSPQE ISAMVLTKMK EIAEAKIGKK VEKAVITVPA

     151  YFNDAQRQAT KDAGAISGLN VLRIINEPTA AAIAYGLGAG KSEKERHVLI

     201  FDLGGGTFDV SLLHIAGGVY TVKSTSGNTH LGGQDFDTNL LEHFKAEFKK

     251  KTGLDISDDA RALRRLRTAA ERAKRTLSSV TQTTVEVDSL FDGEDFESSL

     301  TRARFEDLNA ALFKSTLEPV EQVLKDAKIS KSQIDEVVLV GGSTRIPKVQ

     351  KLLSDFFDGK QLEKSINPDE AVAYGAAVQG AILTGQSTSD ETKDLLLLDV

     401  APLSLGVGMQ GDMFGIVVPR NTTVPTIKRR TFTTCADNQT TVQFPVYQGE

     451  RVNCKENTLL GEFDLKNIPM MPAGEPVLEA IFEVDANGIL KVTAVEKSTG

     501  KSSNITISNA VGRLSSEEIE KMVNQAEEFK AADEAFAKKH EARQRLESYV

     551  ASIEQTVTDP VLSSKLKRGS KSKIEAALSD ALAALQIEDP SADELRKAEV

     601  GLKRVVTKAM SSR*

Protein Sequence for MIT_Smik_c196_2387:

MIT_Smik_c196_2387  Length: 614  Mon Nov  7 14:59:37 2016  Type: P  Check: 4653  ..

       1  MAEGVFQGAI GIDLGTTYSC VATYESSVEI IANEQGNRVT PSFVAFTPEE

      51  RLIGDAAKNQ AALNPRNTVF DAKRLIGRRF DDESVQKDMK TWPFKVIDVD

     101  GNPVIEVQYL EETKTFSPQE ISAMVLTKMK EIAEAKIGKK VEKAVITVPA

     151  YFNDAQRQAT KDAGAISGLN VLRIINEPTA AAIAYGLGAG KSEKERHVLI

     201  FDLGGGTFDV SLLHIAGGVY TVKSTSGNTH LGGQDFDTNL LEHFKAEFKK

     251  KTGLDISDDA RALRRLRTAA ERAKRTLSSV TQTTVEVDSL FDGEDFESSL

     301  TRARFEDLNA PLFKSTLEPV EQVLKDAKIS KSQIDEVVLV GGSTRIPKVQ

     351  KLLSDFFDGK QLEKSINPDE AVAYGAAVQG AILTGQSTSD ETKDLLLLDV

     401  APLSLGVGMQ GDMFGIVVPR NTTVPTIKRR TFTTCADNQT TVQFPVYQGE

     451  RVNCKENTLL GEFDLKNIPM MPAGEPVLEA IFEVDANGIL KVTAVEKSTG

     501  KSSNITISNA VGRLSSEEIE KMVNQAEEFK AADEAFAKKH EARQRLESYV

     551  ASIEQTVTDP VLSSKLKRGS KSKIEAALSD ALAALQIEDP SADELRKAEV

     601  GLKRVVTKAM SSR*

Protein Sequence for MIT_Spar_c429_2913:

MIT_Spar_c429_2913  Length: 614  Mon Nov  7 14:59:37 2016  Type: P  Check: 4653  ..

       1  MAEGVFQGAI GIDLGTTYSC VATYESSVEI IANEQGNRVT PSFVAFTPEE

      51  RLIGDAAKNQ AALNPRNTVF DAKRLIGRRF DDESVQKDMK TWPFKVIDVD

     101  GNPVIEVQYL EETKTFSPQE ISAMVLTKMK EIAEAKIGKK VEKAVITVPA

     151  YFNDAQRQAT KDAGAISGLN VLRIINEPTA AAIAYGLGAG KSEKERHVLI

     201  FDLGGGTFDV SLLHIAGGVY TVKSTSGNTH LGGQDFDTNL LEHFKAEFKK

     251  KTGLDISDDA RALRRLRTAA ERAKRTLSSV TQTTVEVDSL FDGEDFESSL

     301  TRARFEDLNA PLFKSTLEPV EQVLKDAKIS KSQIDEVVLV GGSTRIPKVQ

     351  KLLSDFFDGK QLEKSINPDE AVAYGAAVQG AILTGQSTSD ETKDLLLLDV

     401  APLSLGVGMQ GDMFGIVVPR NTTVPTIKRR TFTTCADNQT TVQFPVYQGE

     451  RVNCKENTLL GEFDLKNIPM MPAGEPVLEA IFEVDANGIL KVTAVEKSTG

     501  KSSNITISNA VGRLSSEEIE KMVNQAEEFK AADEAFAKKH EARQRLESYV

     551  ASIEQTVTDP VLSSKLKRGS KSKIEAALSD ALAALQIEDP SADELRKAEV

     601  GLKRVVTKAM SSR*

Protein Sequence for WashU_Sbay_Contig538.4:

WashU_Sbay_Contig538.4  Length: 614  Mon Nov  7 14:59:37 2016  Type: P  Check: 5158  ..

       1  MAEGVFQGAI GIDLGTTYSC VATYESSVEI IANEQGNRVT PSFVAFTPEE

      51  RLIGDAAKNQ AALNPRNTVF DAKRLIGRRF DDESVQKDMK TWPFKVIDVE

     101  GNPVIEVQYL EETKTFSPQE ISAMVLTKMK EIAEAKIGKK VEKAVITVPA

     151  YFNDAQRQAT KDAGSISGLN VLRIINEPTA AAIAYGLGAG KSEKERHVMI

     201  FDLGGGTFDV SLLHIAGGVY TVKSTSGNTH LGGQDFDTNL LEHFKAEFKK

     251  KTGLDISEDA RALRRLRTAA ERAKRTLSSV TQTTVEVDSL FDGEDFESSL

     301  TRARFEDLNA PMFKSTLEPV EQVLKDAKIS KSQIDEVVLV GGSTRIPKVQ

     351  KLLSDFFDGK QLEKSINPDE AVAYGAAVQG AILTGQSTSD ETKDLLLLDV

     401  APLSLGVGMQ GDMFGIVVPR NTTVPTIKRR TFTTCGDNQT TVQFPVYQGE

     451  RVNCKENTLL GEFDLRGIPM MPAGEPVLEA IFEVDANGIL KVTAVEKSTG

     501  KSSNITISNA VGRLSSDEIE KMVNQAEEFK AADEAFAKKH EARQRLESYV

     551  ASIEQNVTDP ILSSKLKRGS KSKIEAALSD AMAALQIEDA STDELRKAEV

     601  GLKRVVTKAM SSR*

Protein Sequence for WashU_Skud_Contig1629.3:

WashU_Skud_Contig1629.3  Length: 614  Mon Nov  7 14:59:37 2016  Type: P  Check: 5559  ..

       1  MAEGVFQGAI GIDLGTTYSC VATYESSVEI IANEQGNRVT PSFVAFTPEE

      51  RLIGDAAKNQ AALNPRNTVF DAKRLIGRRF DDESVQKDMK TWPFKVIDVD

     101  GNPVIEVQYL DETKTFSPQE ISAMVLTKMK EIAEAKIGKK VEKAVITVPA

     151  YFNDAQRQAT KDAGAISGLN VLRIINEPTA AAIAYGLGAG KSEKERHVLI

     201  FDLGGGTFDV SLLHIAGGVY TVKSTSGNTH LGGQDFDTNL LEHFKAEFKK

     251  KTGLDISDDA RALRRLRTAA ERAKRTLSSV TQTTVEVDSL FDGEDFESSL

     301  TRARFEDLNA PLFKSTLEPV EQVLKDAKTS KSQIDEVVLV GGSTRIPKVQ

     351  KLLSDFFDGK QLEKSINPDE AVAYGAAVQG AILTGQSTSE ETKDLLLLDV

     401  APLSLGVGMQ GDIFGIVVPR NTTVPTIKRR TFTTCADNQT TVQFPVYQGE

     451  RVNCKENTLL GEFDLRNIPM MPAGEPVLEA IFEVDANGIL KVTAVEKSTG

     501  KSSNITISNA VGRLSSDEIE KMVNQAEEFK AADEAFAKKH EARQRLESYV

     551  ASIEQTVTDP VLSSKLKRGS KSKIEAALSD ALAALQIEDP STDELRKAEV

     601  GLKRVVTKAM SSR*

Protein Sequence for WashU_Smik_Contig2755.3:

WashU_Smik_Contig2755.3  Length: 614  Mon Nov  7 14:59:37 2016  Type: P  Check: 4653  ..

       1  MAEGVFQGAI GIDLGTTYSC VATYESSVEI IANEQGNRVT PSFVAFTPEE

      51  RLIGDAAKNQ AALNPRNTVF DAKRLIGRRF DDESVQKDMK TWPFKVIDVD

     101  GNPVIEVQYL EETKTFSPQE ISAMVLTKMK EIAEAKIGKK VEKAVITVPA

     151  YFNDAQRQAT KDAGAISGLN VLRIINEPTA AAIAYGLGAG KSEKERHVLI

     201  FDLGGGTFDV SLLHIAGGVY TVKSTSGNTH LGGQDFDTNL LEHFKAEFKK

     251  KTGLDISDDA RALRRLRTAA ERAKRTLSSV TQTTVEVDSL FDGEDFESSL

     301  TRARFEDLNA PLFKSTLEPV EQVLKDAKIS KSQIDEVVLV GGSTRIPKVQ

     351  KLLSDFFDGK QLEKSINPDE AVAYGAAVQG AILTGQSTSD ETKDLLLLDV

     401  APLSLGVGMQ GDMFGIVVPR NTTVPTIKRR TFTTCADNQT TVQFPVYQGE

     451  RVNCKENTLL GEFDLKNIPM MPAGEPVLEA IFEVDANGIL KVTAVEKSTG

     501  KSSNITISNA VGRLSSEEIE KMVNQAEEFK AADEAFAKKH EARQRLESYV

     551  ASIEQTVTDP VLSSKLKRGS KSKIEAALSD ALAALQIEDP SADELRKAEV

     601  GLKRVVTKAM SSR*