Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YDL220C and Homologs


Choose two or more sequences for alignment:
Pick a sequence type:
Best Hits & Orthologs"Other" Hits

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_CDC13/YDL220C   1   ------------------------------MDTLEEPECPPHKNRIFVSS   20
MIT_Smik_c194_2424   1   MRDTDLAMVSKIIILNDILSLYVYGSICIRMDTLEEPECPEHEDRVFVKS   50
MIT_Spar_c429_2954   1   ------------------------------MDTLEEPECPPHKERIFVKS   20
WashU_Sbay_Contig535.11   1   ------------------------------MDTLEEPEFPPHKPRVFVES   20
WashU_Scas_Contig677.11   1   ----------------------------------------MSESCVFITS   10
WashU_Sklu_Contig2236.3   1   ----------------------------------MQANATEYKYIDSPRD   16
WashU_Skud_Contig1815.8   1   --------MLEICFYMSSLALQGYGKIHMKMDTLEEPESSPHRARVFVTS   42
WashU_Smik_Contig2278.3   1   ------------------------------MDTLEEPECPEHEDRVFVKS   20
Symbols






. .



SGD_Scer_CDC13/YDL220C   21   SKDFEGYPSKAIVPVQFVALLTSIHLT-ETKCLLGFSNFERRGDQSQEDQ   69
MIT_Smik_c194_2424   51   SKDFEGYASKAIVPVHFVALLTSIYLT-ETKGLLVFSNFEEGESQVEKDQ   99
MIT_Spar_c429_2954   21   SKDFEGYPSIAIVPVQFVALLTSIHLT-ETKCLLGFSNFEGRDDQVEEDQ   69
WashU_Sbay_Contig535.11   21   AKEFESFPDDAIVPVQFVSVLTSIRLT-ETKCLLGFSSFEGGRD-RMGQR   68
WashU_Scas_Contig677.11   11   PSQFQRFPDSKQISLRFVSLLTGIKYN-GKNFILELSDFD---NNNVISP   56
WashU_Sklu_Contig2236.3   17   LEAYYSNDEIVTHNIRFISVLTSLEFIPNKKCLFIFQNFEHGRP--DECP   64
WashU_Skud_Contig1815.8   43   TKEFERYPSKAIVPVQFVALLTSIHLT-ETKCLLSFSNFMGGEDPVEN-R   90
WashU_Smik_Contig2278.3   21   SKDFEGYASKAIVPVHFVALLTSIYLT-ETKGLLVFSNFEEGESQVEKDQ   69
Symbols






. : . ::*:::**.: .: :: :..*



SGD_Scer_CDC13/YDL220C   70   YLIKLKFKDRGSERLARITISLLCQYFDIELPDLDSDSGASPTVILRDIH   119
MIT_Smik_c194_2424   100   YIIKLKFKDRSSERLARMTISLLCQYFDIELPDLDSGS----TLILKDIH   145
MIT_Spar_c429_2954   70   YLIKVKFKDRSSERLARMTISLLCQYFEIELPDLDSGSDSSSTVVLRDIH   119
WashU_Sbay_Contig535.11   69   YTVKLKFKDKSAERLARMTISLVCRYFDIELPDSDLGTESCPAFLLEDIH   118
WashU_Scas_Contig677.11   57   YRVKLRCSDENAKRLAQMTISLLCQFFDFEIPELRTLS---DPFFIDEIQ   103
WashU_Sklu_Contig2236.3   65   YTAKIRCDTAETSTLTRMMLSLIAQQFDLDLPDLDDPS----GFHLRGIY   110
WashU_Skud_Contig1815.8   91   YIIKLKFKDRSSERLARMTISLLCQYFDIEFPDLDSRS----ALVLEDIH   136
WashU_Smik_Contig2278.3   70   YIIKLKFKDRSSERLARMTISLLCQYFDIELPDLDSGS----TLILKDIH   115
Symbols






* *:: . :. *::: :**:.: *::::*: : . : *



SGD_Scer_CDC13/YDL220C   120   LERLCFSSCKALYVSKHGNYTLFLEDIKPLDLVSVISTISTKSTN-SSKH   168
MIT_Smik_c194_2424   146   LERLCFSSCKALYVSRSGNYTLFLEDIKPLDIVNVINSISTKSQKSGTEF   195
MIT_Spar_c429_2954   120   LERLCFSSCKALYVSKHGNYTLFLEDIKPLDLVNVIRTISTKSKKGSSEH   169
WashU_Sbay_Contig535.11   119   FERLCFSSCKTLYVSRHGNYTLFLEDIKPLDLAYVINTISKGPKISSNGV   168
WashU_Scas_Contig677.11   104   LDRLCFINCKVIYIGKDDKYSLFLDDIKPIDLNNAIRIAR----------   143
WashU_Sklu_Contig2236.3   111   FERLCFVKCQGRFVSTKNKGSIFLQDIRCIDLNGTLYTAR----------   150
WashU_Skud_Contig1815.8   137   LERLCFSSCKALYVSKHGNYTLFLEDIKPLDRMSVINIISTDSKLSGSNG   186
WashU_Smik_Contig2278.3   116   LERLCFSSCKALYVSRSGNYTLFLEDIKPLDIVNVINSISTKSQKSGTEF   165
Symbols






::**** .*: ::. .: ::**:**: :* .:



SGD_Scer_CDC13/YDL220C   169   SSSELISECDLNNSLVDIFNNLIEMNRDEKNRFKFVKLIHYDIELKKFVQ   218
MIT_Smik_c194_2424   196   LPSGPIIESNLREPLLDIFNNLIKMNIDERNSFKFVRLIHYNTELKRFIQ   245
MIT_Spar_c429_2954   170   LLLEPTSKCNLKRSLVDIFNNLIEMNRDEKNSFKFVKLIHYDIELKRFIQ   219
WashU_Sbay_Contig535.11   169   CLSAPNAGPELKKSLAAIFDNLIAMNRDQKNSFKFVKLTHYDIEFKEFIQ   218
WashU_Scas_Contig677.11   144   ----QLQSTLEQRTILKIFDNLIKLNNESRNGFKFVKLDNYNNEFAQFIQ   189
WashU_Sklu_Contig2236.3   151   ----TFKESNEITTLNRIFDNLIRLNNDPKNDFKFVKLLNYDHDMKKFIQ   196
WashU_Skud_Contig1815.8   187   SLSGPSLKPHLKESLTDIFNNLIKINKDEKNCFKFVKLIDYDMELKKFIQ   236
WashU_Smik_Contig2278.3   166   LPSGPIIESNLREPLLDIFNNLIKMNIDERNSFKFVRLIHYNTELKKFIQ   215
Symbols






.: **:*** :* : :* ****:* .*: :: .*:*



SGD_Scer_CDC13/YDL220C   219   DQQK---------------------------VLSQKSKAAAINPFFVPNR   241
MIT_Smik_c194_2424   246   EQQS---------------------------LLSQKSKTKLINPFFAPNR   268
MIT_Spar_c429_2954   220   EQQN---------------------------ILSQKLKAKAINPFFAPNR   242
WashU_Sbay_Contig535.11   219   ERQR---------------------------LLSQKAKPSAVDPFFVPNR   241
WashU_Scas_Contig677.11   190   EKQT---------------------------MVNSRKKTTIIN--NNPLF   210
WashU_Sklu_Contig2236.3   197   NRQENLALTNFRKNPIFGVNRYLSAQESQDDFDSQRMETQSTLFGFTALG   246
WashU_Skud_Contig1815.8   237   ERQE---------------------------LLLQESKPKPVDPFFVPNR   259
WashU_Smik_Contig2278.3   216   EQQS---------------------------LLSQKSKTKLINPFFAPNR   238
Symbols






::* . .. :. .



SGD_Scer_CDC13/YDL220C   242   LGIPYIESQNEFNSQLMTLNVDEPTTDISNMGEEMHDSADPIEDSDSS--   289
MIT_Smik_c194_2424   269   LGIPYVETQNEFNSQLMTLNSEQPITDISSNGDDMRYSADPIEESDSS--   316
MIT_Spar_c429_2954   243   LGIPYLESQNEFNSQLMTLNVDEPITEIGDKGDNMHDSADPIEDSDSS--   290
WashU_Sbay_Contig535.11   242   LGAPSLESQNEFNSQLMTLNADEEVPNTSGRKDDPDASSDPIEDSDASS-   290
WashU_Scas_Contig677.11   211   RSHITDTRENEMTSQFDFNSQYLNTENSNDSTSPSHDSIDPIEESDAN--   258
WashU_Sklu_Contig2236.3   247   HDNPTDIQQTHSKHSPPGLSGTLHDTSTEDLIEESDSSTSEFMATPVSFR   296
WashU_Skud_Contig1815.8   260   MGVPYLESQNEFNSQLMTLNAAESIANTASRREDLNDTADPIEDSDAS--   307
WashU_Smik_Contig2278.3   239   LGIPYVETQNEFNSQLMTLNSEQPITDISSNGDDMRYSTDPIEESDSS--   286
Symbols






. :.. . . . . . . : . : : .



SGD_Scer_CDC13/YDL220C   290   --------------------------------------------TTSSTG   295
MIT_Smik_c194_2424   317   --------------------------------------------TISSTG   322
MIT_Spar_c429_2954   291   --------------------------------------------TTSSTG   296
WashU_Sbay_Contig535.11   291   --------------------------------------------SSSSTG   296
WashU_Scas_Contig677.11   259   -----------------------------------------------SSS   261
WashU_Sklu_Contig2236.3   297   SCRNNTKNTADPPKVVRPDLTTSNSRHLQSSEESGLPLNPGESNLLFQRN   346
WashU_Skud_Contig1815.8   308   --------------------------------------------TASSTS   313
WashU_Smik_Contig2278.3   287   --------------------------------------------TISSTG   292
Symbols






. .



SGD_Scer_CDC13/YDL220C   296   KYFSSKSYIQSQTPERKTSVPNNWH-------------------------   320
MIT_Smik_c194_2424   323   KFVSPGSCIQSHTPERKTSVPNNWL-------------------------   347
MIT_Spar_c429_2954   297   KYFSSRSYIQSQTPERKTSVPNNWH-------------------------   321
WashU_Sbay_Contig535.11   297   TFLSSRSYIQSQTPERKTKVPNNWL-------------------------   321
WashU_Scas_Contig677.11   262   IHLSRNTSRQSITTERSPKLRKLNK-------------------------   286
WashU_Sklu_Contig2236.3   347   VYTRITAMIAEHSKERESAIARRASNVVMSQSIPDITPKNGTNQTDDRAL   396
WashU_Skud_Contig1815.8   314   PFLSSRSYIQTQTPERKARVPDNWV-------------------------   338
WashU_Smik_Contig2278.3   293   KFVSPGSCIQSHTPERKTSVPNNWL-------------------------   317
Symbols






. : : **.. :



SGD_Scer_CDC13/YDL220C   321   ------------DDDSGSKRKRKLSFHSPNASSIRKAISYEQLSLASVGS   358
MIT_Smik_c194_2424   348   ------------DNDSEGKNKRRLSFQCTSAPSSQQVIDYERLSLAKVGS   385
MIT_Spar_c429_2954   322   ------------DDDSGRNKKRKLSFQGPSAPLSQKAISYERLSLANVGS   359
WashU_Sbay_Contig535.11   322   ------------DRTSE-RKKRKLSFTDRTAPSSQLGIDYERLSLASLGS   358
WashU_Scas_Contig677.11   287   ------------NSKPVANKPE-------------------YYRCVDIGT   305
WashU_Sklu_Contig2236.3   397   HRSNFQPEPSTVTSTDTNEQLKKRQKLDIPTLHIAVFPEILSLVHASPNR   446
WashU_Skud_Contig1815.8   339   ------------DRDFEGKKKRKLSFTTGGTP-----VDYERLSLAGVGT   371
WashU_Smik_Contig2278.3   318   ------------DNDSEGKNKRRLSFQCTSAPSSQQIIDYERLSLAKVGS   355
Symbols






.. . . .



SGD_Scer_CDC13/YDL220C   359   VERLEGKIVGMNPP----QFASINEFKYCTLKLYFT-QLLPN-VPDKVLV   402
MIT_Smik_c194_2424   386   VERLKGKFVGMYPS----HFSGITEFRYCTLKLYFT-HLSVSKIPDKILI   430
MIT_Spar_c429_2954   360   VERLEGKFVGMYPT----QFASINEFKYCTLKLYYT-HLPLSNIPDKVLL   404
WashU_Sbay_Contig535.11   359   METFEGKFVGMYPP----EFHSVDDFKHCSLKLYFT-PLPLSGPLDRVLV   403
WashU_Scas_Contig677.11   306   ICEIQGKLVGSIPLNLIESNLNASPARFFFIPNEWTEGKEGNDEAMIKLL   355
WashU_Sklu_Contig2236.3   447   TFRLQGKFVGMLPN----ELQKKVPQKISTLKLYFQPASWDEKVLSSKYL   492
WashU_Skud_Contig1815.8   372   VERFQGKFVGMYPP----EFSSISEFKRCTLKLYFTSFLPSSKTPDSVLI   417
WashU_Smik_Contig2278.3   356   VERLKGKFVGMYPS----HFSGITEFRYCTLKLYFT-HLSVSKIPDKILI   400
Symbols






::**:** * : : : . :



SGD_Scer_CDC13/YDL220C   403   PG-VNCIEIVIPTRERICELFGVLNCQSDKISDILLLEKPDRISVEVERI   451
MIT_Smik_c194_2424   431   PG-TNCIEIIIPTMERIRELFGVLNCQNSMISNILLLDKPDPISVEIERV   479
MIT_Spar_c429_2954   405   PG-TNCIEIIIPTRERICELFGVLNCQSSKISDILLLKTPGPISVEIERI   453
WashU_Sbay_Contig535.11   404   PS-VNCLEIIIPTIERIRELFGLLNCQSDKISAILLMDKPDLISVEIERI   452
WashU_Scas_Contig677.11   356   PN-YNCIEVLVSKFSELKGIFSKFTTDFTKLNHFLLNNKVQVRIVRSKFP   404
WashU_Sklu_Contig2236.3   493   NASKNCLEVVTCNIDQLLDIFSLSKQPDNRSLLGDISTVLLYRTFEVKIQ   542
WashU_Skud_Contig1815.8   418   PG-TNCIEIIIPTTERIRELFGTLNCQSSKISNILLLNKPHPISVEIEKI   466
WashU_Smik_Contig2278.3   401   PG-TNCIEIIIPTMERIRELFGVLNCQNSMISNILLLDKPDPISVEIERV   449
Symbols






**:*:: . ..: :*. . : .. :



SGD_Scer_CDC13/YDL220C   452   LWDND-------KTASPGMAVWSLKNISTDTQAQAQVQVPAQSSASIDPS   494
MIT_Smik_c194_2424   480   MWNND-------ETISPGLTVWSLKNISVKTQAQASAQSPAKSLPPVNAP   522
MIT_Spar_c429_2954   454   MWDND-------ETISPGIAVWSLKNISTDTQAQAPVQS----LPPTNPP   492
WashU_Sbay_Contig535.11   453   LWDND-------ETVSPGLAVWSLKNICADTHVQPPAPRAS---SPSNPP   492
WashU_Scas_Contig677.11   405   FKLLKNDTFHAYNKEHAFAPIWTLQDIDLLPSKIPKKKAVPRLLPSTIAN   454
WashU_Sklu_Contig2236.3   543   KRRVS-------MAGIFYSFCWSLTDISTDSPKKIEEKRSQSSFPVAKGV   585
WashU_Skud_Contig1815.8   467   MWEND-------ETIRPGLAVWNLKNINTDTQVKAPAPLS----PLVNPL   505
WashU_Smik_Contig2278.3   450   MWNND-------ETISPGLTVWSLKNISVKTQAQASAQSPAKSLPPVNAP   492
Symbols






. *.* :* . .



SGD_Scer_CDC13/YDL220C   495   R---------TRMSKMARKDPTIEFCQLGLD-TFETKYITMFGMLVSCSF   534
MIT_Smik_c194_2424   523   R---------TKMRKMAEKDPTIEFCHLELN-TFETKYVTMFGMLVSCSF   562
MIT_Spar_c429_2954   493   R---------TRMREMARKDPTIEFCQLELN-NFETKYVTMFGMLVSCSF   532
WashU_Sbay_Contig535.11   493   R---------LKMRELAKKDPTIEFRELGLG-AFDTKFVTMFGMLVSCSF   532
WashU_Scas_Contig677.11   455   NQDEDLNKILNQQFERTKNDSVIKFEELRLS-PHEVKFVTMFGLLVSVTF   503
WashU_Sklu_Contig2236.3   586   TP---------LQHRTYRVDPVKTVGELSVKKEGEVEFVTIFALMVAAKI   626
WashU_Skud_Contig1815.8   506   R---------TKIRELANKDPTIEFRELQLN-TFEAKYVTMFGMLVSCSF   545
WashU_Smik_Contig2278.3   493   R---------TKMRKMAEKDPTIEFCHLELN-TFETKYVTMFGMLVSCSF   532
Symbols






. . *.. . .* : :.:::*:*.::*: .:



SGD_Scer_CDC13/YDL220C   535   DKPAFISFVFSDFTKNDIVQNYLYDRYLIDYENKLELNEGFKAIMYKNQF   584
MIT_Smik_c194_2424   563   DKPAFVSFVFTDFTTNDIVQNYLYDRYLVDYEAKLELNEGFKAIMYRNQF   612
MIT_Spar_c429_2954   533   DKPSFISFVFTDFTKNDIVQNYLYDRYLIDYESKLELNEGFKAIMYKNQF   582
WashU_Sbay_Contig535.11   533   DKPAFSSFVFTDFTKNDITQNYLYDRYLVDYEAKLDLNEGFKAIMYKNQF   582
WashU_Scas_Contig677.11   504   ENSQYVSLVFTDFTTNSIDQKYLFGNYLIDPIVRMNGDQGFRVIMYPEHF   553
WashU_Sklu_Contig2236.3   627   NDPYKKRFVFTDFTANPLTGSYTFDPFICSYHNRISSTETLHSVMYDDEY   676
WashU_Skud_Contig1815.8   546   DKPAFISFVFTDFTKNDIVQNYLYDRYLVDYEAKLELNEGFKAIMYKNQF   595
WashU_Smik_Contig2278.3   533   DKPAFVSFVFTDFTTNDIVQNYLYDRYLVDYEAKLELNEGFKAIMYRNQF   582
Symbols






:.. :**:*** * : .* :. :: . ::. : :: :** :.:



SGD_Scer_CDC13/YDL220C   585   ETFDSKLRKIFNNGLRDLQNGRDENLSQYGIVCKMNIKVKMYNGKLNAIV   634
MIT_Smik_c194_2424   613   ETFDSKILNIFNKRLNELQNGRDENLSQHGIVCKMNIKVKIYNGKLNAIV   662
MIT_Spar_c429_2954   583   ETFDTKIRQIFNKGLSDLRNGRDENLSQYGIVCKMNIKVKIYNGKLNAIV   632
WashU_Sbay_Contig535.11   583   EVFDSHIEKIFGKRLKDLQNGNDENVSQHGIVCKMNMKVKIYNGKLNAIR   632
WashU_Scas_Contig677.11   554   EIFNRNVAKVFGSTLKDLLNGR-ENITNKGIVCKISLKLKFFTNKLNAIS   602
WashU_Sklu_Contig2236.3   677   GKFLNRITQCMRCKFEDLFNVKDSNLTHRGIVCKLGLRVKIYKGKLDGVI   726
WashU_Skud_Contig1815.8   596   EGFDSGIEKIFAKRLSSLRNGRDENVSQYGIVCKMNVKVKIYNGKLNAIL   645
WashU_Smik_Contig2278.3   583   ENIX----------------------------------------------   586
Symbols






:



SGD_Scer_CDC13/YDL220C   635   RECEPVPHSQISSIASPSQCEHLRLFYQRAFKRIGESAISRYFEEYRRFF   684
MIT_Smik_c194_2424   663   RECVPVLQSQVRSVASPSQSEHLRSFYQRAFKRIGESAISRYFEEYQRFF   712
MIT_Spar_c429_2954   633   RECVPVPHSQVGSIASPPQCEHLRSFYKRAFKRIGESAISRYYEEYRRFF   682
WashU_Sbay_Contig535.11   633   ARMRTGPVRPGKHPSDAHAVRAFAVVVPAGIRQTRRVCHLTLFRSVHSVF   682
WashU_Scas_Contig677.11   603   RVCIPILTS--NNELSLKEYSILDHIYKNALTNIHEYDMDKCFDSFVKCF   650
WashU_Sklu_Contig2236.3   727   RSCIPMMND---SKLTHMERTKLHDFYTRAIKRIPKVHLDTFYSNFQKFF   773
WashU_Skud_Contig1815.8   646   RDCVPVPRSQADRIASPSQCEHLASFYQRAFDRIGESAISRYFEDYRTFF   695
WashU_Smik_Contig2278.3   
   --------------------------------------------------   
Symbols










SGD_Scer_CDC13/YDL220C   685   PIHRNGS---HLAKLRFD--EVKHEPKKSPTTPALAEHIPDLNADVSSFD   729
MIT_Smik_c194_2424   713   PIQRNKTSHLAQLKPAVSGHEQDHEPGQLHTSMVPTEYIPDLNADVSSFD   762
MIT_Spar_c429_2954   683   PIQRNNS---HLAELKFAPVTVKHEREQLRAPTAPTEYIPDLNADVSSFD   729
WashU_Sbay_Contig535.11   683   PHTKKQAP-----------------PRGTATRRGQTQPRTDTGADRTSS-   714
WashU_Scas_Contig677.11   651   PYKRQADG----------KIIVTSSTEERELSLILDDDDDDDDNDNDHQL   690
WashU_Sklu_Contig2236.3   774   PLTINQDG--------------QVELKKSEHDRLLDELYDSDGAEYASKN   809
WashU_Skud_Contig1815.8   696   PIQRNDS-HLAGLKPAVANHRQEREPAELQTAPALNEYIPDLNADVSSFD   744
WashU_Smik_Contig2278.3   
   --------------------------------------------------   
Symbols










SGD_Scer_CDC13/YDL220C   730   VKFTDISSLLD-SSARLPRPQQTHKSNTLYSCEGRIIAIEYHASDLCFHI   778
MIT_Smik_c194_2424   763   IECTDIFPLLN-SLSRCPHPRQIHKTSTLYSCRGRIIAIEYTASDICFHI   811
MIT_Spar_c429_2954   730   VKFTDIFSLLN-SFARCP--QQTHKSNTLYNCEGRIVAIEHHASGLCFHI   776
WashU_Sbay_Contig535.11   
   --------------------------------------------------   
WashU_Scas_Contig677.11   691   ETDDNNANLSSLMNEKSFKEGETQDSIPDINIDATPYRIQENNNIPLLNV   740
WashU_Sklu_Contig2236.3   810   VDPEDTSHAEP---------------------VEQIIPQLGSYLGDFEVV   838
WashU_Skud_Contig1815.8   745   VEFTDVFQLLNSLAHRRTRPQQTRKSNTLYSCEGRIIAIEYHPSDICFHI   794
WashU_Smik_Contig2278.3   
   --------------------------------------------------   
Symbols










SGD_Scer_CDC13/YDL220C   779   TNELPLLQTRGLAPERVLQLHI------ITSKNFAYFFNRSSAYLQRQPL   822
MIT_Smik_c194_2424   812   TNEFSLSQGRSADSQKVLKLHI------ITPKNFAYFFNRPNAYIQRQSL   855
MIT_Spar_c429_2954   777   TNELPLSQTRIPAPQRVLQLHI------ITSKNFAYFFNRSGAYLQRQPL   820
WashU_Sbay_Contig535.11   715   -----------------KRIHP------GPERRRVVLRRRVHGHLPAPPL   741
WashU_Scas_Contig677.11   741   LQDDEPVIFRVSGKLINVEYHPSYLALTITNDTFAKDAIEWTRILKIEVF   790
WashU_Sklu_Contig2236.3   839   KNLDIPALNTIEKLTPKKVYHVQGKVVDITQDDDCLSFLITNDLISEGVL   888
WashU_Skud_Contig1815.8   795   TDGR--------DPHRALQLHI------TSSKNFAYFFNGSNTYLQGHHL   830
WashU_Smik_Contig2278.3   
   --------------------------------------------------   
Symbols










SGD_Scer_CDC13/YDL220C   823   EEKYTQLAQFLGHSFKFNITSSLTLFPDTTVALQIWCPIECTFRELQQQL   872
MIT_Smik_c194_2424   856   EEICTQLTQFLGHSFQFNITSSYKLLPETALALQIWCPIECTLRELQQQL   905
MIT_Spar_c429_2954   821   EEKYAQLAQFLGHSFKFNITSSLKFLPGTTMTLQIWCPIECTFRELQQQL   870
WashU_Sbay_Contig535.11   742   LGPPPTTTAQEPHALQLRGPRHRHRVPPNTPLFSHHGX------------   779
WashU_Scas_Contig677.11   791   SSENIRYFFNAGVEPPLVEMSTQSQVLSTENAINIEDNLNILKGFVGKEF   840
WashU_Sklu_Contig2236.3   889   DPTRILKVDIIGQDNLDYFYNQRDYKAFQNDLTLLVG----------KIL   928
WashU_Skud_Contig1815.8   831   EKTHNQLARFLGHPFKFNITSSFKSLPGTAMALQIWYPIECTFRELQQQL   880
WashU_Smik_Contig2278.3   
   --------------------------------------------------   
Symbols










SGD_Scer_CDC13/YDL220C   873   AHPKVAAAPDSGSLDCAINATVNPLRLLAAQNGVTVKKEEDNDDDAGAVP   922
MIT_Smik_c194_2424   906   AHLKAATTPDSGSLGYAITAAVNPPRFLAAQDGVTVKKEEDNGDEAGTFS   955
MIT_Spar_c429_2954   871   AHLKVAAAPDSGSLGCAITATVNPLRLLAAQNGVTVKREEDNDDDAGAVS   920
WashU_Sbay_Contig535.11   
   --------------------------------------------------   
WashU_Scas_Contig677.11   841   SFKITKGTLKLFTNIGVSVWCPVEYTLEEMKGQMMLRHDRDAKDSKKPLT   890
WashU_Sklu_Contig2236.3   929   AFRLSRVLIAVSSKKRLFAWYPVECTMEEMKSQLQKQLTVSVKQEQIDLT   978
WashU_Skud_Contig1815.8   881   AHLMAAATSNSGSLVYGITATANPPQLLAALDGVTVKREEDNDDDAEAVP   930
WashU_Smik_Contig2278.3   
   --------------------------------------------------   
Symbols










SGD_Scer_CDC13/YDL220C   923   TS----------------   924
MIT_Smik_c194_2424   956   ASWDTIGAAQRGGAKFQ-   972
MIT_Spar_c429_2954   921   ASLDMMGAAKCGGAKLQ-   937
WashU_Sbay_Contig535.11   
   ------------------   
WashU_Scas_Contig677.11   891   SSHGMVKQETHSLVEIID   908
WashU_Sklu_Contig2236.3   979   DM----------------   980
WashU_Skud_Contig1815.8   931   AS----------------   932
WashU_Smik_Contig2278.3   
   ------------------   
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_CDC13/YDL220C:

SGD_Scer_CDC13/YDL220C  Length: 925  Mon Nov  7 14:59:26 2016  Type: P  Check: 9920  ..

       1  MDTLEEPECP PHKNRIFVSS SKDFEGYPSK AIVPVQFVAL LTSIHLTETK

      51  CLLGFSNFER RGDQSQEDQY LIKLKFKDRG SERLARITIS LLCQYFDIEL

     101  PDLDSDSGAS PTVILRDIHL ERLCFSSCKA LYVSKHGNYT LFLEDIKPLD

     151  LVSVISTIST KSTNSSKHSS SELISECDLN NSLVDIFNNL IEMNRDEKNR

     201  FKFVKLIHYD IELKKFVQDQ QKVLSQKSKA AAINPFFVPN RLGIPYIESQ

     251  NEFNSQLMTL NVDEPTTDIS NMGEEMHDSA DPIEDSDSST TSSTGKYFSS

     301  KSYIQSQTPE RKTSVPNNWH DDDSGSKRKR KLSFHSPNAS SIRKAISYEQ

     351  LSLASVGSVE RLEGKIVGMN PPQFASINEF KYCTLKLYFT QLLPNVPDKV

     401  LVPGVNCIEI VIPTRERICE LFGVLNCQSD KISDILLLEK PDRISVEVER

     451  ILWDNDKTAS PGMAVWSLKN ISTDTQAQAQ VQVPAQSSAS IDPSRTRMSK

     501  MARKDPTIEF CQLGLDTFET KYITMFGMLV SCSFDKPAFI SFVFSDFTKN

     551  DIVQNYLYDR YLIDYENKLE LNEGFKAIMY KNQFETFDSK LRKIFNNGLR

     601  DLQNGRDENL SQYGIVCKMN IKVKMYNGKL NAIVRECEPV PHSQISSIAS

     651  PSQCEHLRLF YQRAFKRIGE SAISRYFEEY RRFFPIHRNG SHLAKLRFDE

     701  VKHEPKKSPT TPALAEHIPD LNADVSSFDV KFTDISSLLD SSARLPRPQQ

     751  THKSNTLYSC EGRIIAIEYH ASDLCFHITN ELPLLQTRGL APERVLQLHI

     801  ITSKNFAYFF NRSSAYLQRQ PLEEKYTQLA QFLGHSFKFN ITSSLTLFPD

     851  TTVALQIWCP IECTFRELQQ QLAHPKVAAA PDSGSLDCAI NATVNPLRLL

     901  AAQNGVTVKK EEDNDDDAGA VPTS*

Protein Sequence for MIT_Smik_c194_2424:

MIT_Smik_c194_2424  Length: 973  Mon Nov  7 14:59:26 2016  Type: P  Check: 8763  ..

       1  MRDTDLAMVS KIIILNDILS LYVYGSICIR MDTLEEPECP EHEDRVFVKS

      51  SKDFEGYASK AIVPVHFVAL LTSIYLTETK GLLVFSNFEE GESQVEKDQY

     101  IIKLKFKDRS SERLARMTIS LLCQYFDIEL PDLDSGSTLI LKDIHLERLC

     151  FSSCKALYVS RSGNYTLFLE DIKPLDIVNV INSISTKSQK SGTEFLPSGP

     201  IIESNLREPL LDIFNNLIKM NIDERNSFKF VRLIHYNTEL KRFIQEQQSL

     251  LSQKSKTKLI NPFFAPNRLG IPYVETQNEF NSQLMTLNSE QPITDISSNG

     301  DDMRYSADPI EESDSSTISS TGKFVSPGSC IQSHTPERKT SVPNNWLDND

     351  SEGKNKRRLS FQCTSAPSSQ QVIDYERLSL AKVGSVERLK GKFVGMYPSH

     401  FSGITEFRYC TLKLYFTHLS VSKIPDKILI PGTNCIEIII PTMERIRELF

     451  GVLNCQNSMI SNILLLDKPD PISVEIERVM WNNDETISPG LTVWSLKNIS

     501  VKTQAQASAQ SPAKSLPPVN APRTKMRKMA EKDPTIEFCH LELNTFETKY

     551  VTMFGMLVSC SFDKPAFVSF VFTDFTTNDI VQNYLYDRYL VDYEAKLELN

     601  EGFKAIMYRN QFETFDSKIL NIFNKRLNEL QNGRDENLSQ HGIVCKMNIK

     651  VKIYNGKLNA IVRECVPVLQ SQVRSVASPS QSEHLRSFYQ RAFKRIGESA

     701  ISRYFEEYQR FFPIQRNKTS HLAQLKPAVS GHEQDHEPGQ LHTSMVPTEY

     751  IPDLNADVSS FDIECTDIFP LLNSLSRCPH PRQIHKTSTL YSCRGRIIAI

     801  EYTASDICFH ITNEFSLSQG RSADSQKVLK LHIITPKNFA YFFNRPNAYI

     851  QRQSLEEICT QLTQFLGHSF QFNITSSYKL LPETALALQI WCPIECTLRE

     901  LQQQLAHLKA ATTPDSGSLG YAITAAVNPP RFLAAQDGVT VKKEEDNGDE

     951  AGTFSASWDT IGAAQRGGAK FQ*

Protein Sequence for MIT_Spar_c429_2954:

MIT_Spar_c429_2954  Length: 938  Mon Nov  7 14:59:26 2016  Type: P  Check: 9880  ..

       1  MDTLEEPECP PHKERIFVKS SKDFEGYPSI AIVPVQFVAL LTSIHLTETK

      51  CLLGFSNFEG RDDQVEEDQY LIKVKFKDRS SERLARMTIS LLCQYFEIEL

     101  PDLDSGSDSS STVVLRDIHL ERLCFSSCKA LYVSKHGNYT LFLEDIKPLD

     151  LVNVIRTIST KSKKGSSEHL LLEPTSKCNL KRSLVDIFNN LIEMNRDEKN

     201  SFKFVKLIHY DIELKRFIQE QQNILSQKLK AKAINPFFAP NRLGIPYLES

     251  QNEFNSQLMT LNVDEPITEI GDKGDNMHDS ADPIEDSDSS TTSSTGKYFS

     301  SRSYIQSQTP ERKTSVPNNW HDDDSGRNKK RKLSFQGPSA PLSQKAISYE

     351  RLSLANVGSV ERLEGKFVGM YPTQFASINE FKYCTLKLYY THLPLSNIPD

     401  KVLLPGTNCI EIIIPTRERI CELFGVLNCQ SSKISDILLL KTPGPISVEI

     451  ERIMWDNDET ISPGIAVWSL KNISTDTQAQ APVQSLPPTN PPRTRMREMA

     501  RKDPTIEFCQ LELNNFETKY VTMFGMLVSC SFDKPSFISF VFTDFTKNDI

     551  VQNYLYDRYL IDYESKLELN EGFKAIMYKN QFETFDTKIR QIFNKGLSDL

     601  RNGRDENLSQ YGIVCKMNIK VKIYNGKLNA IVRECVPVPH SQVGSIASPP

     651  QCEHLRSFYK RAFKRIGESA ISRYYEEYRR FFPIQRNNSH LAELKFAPVT

     701  VKHEREQLRA PTAPTEYIPD LNADVSSFDV KFTDIFSLLN SFARCPQQTH

     751  KSNTLYNCEG RIVAIEHHAS GLCFHITNEL PLSQTRIPAP QRVLQLHIIT

     801  SKNFAYFFNR SGAYLQRQPL EEKYAQLAQF LGHSFKFNIT SSLKFLPGTT

     851  MTLQIWCPIE CTFRELQQQL AHLKVAAAPD SGSLGCAITA TVNPLRLLAA

     901  QNGVTVKREE DNDDDAGAVS ASLDMMGAAK CGGAKLQ*

Protein Sequence for WashU_Sbay_Contig535.11:

WashU_Sbay_Contig535.11  Length: 779  Mon Nov  7 14:59:26 2016  Type: P  Check: 742  ..

       1  MDTLEEPEFP PHKPRVFVES AKEFESFPDD AIVPVQFVSV LTSIRLTETK

      51  CLLGFSSFEG GRDRMGQRYT VKLKFKDKSA ERLARMTISL VCRYFDIELP

     101  DSDLGTESCP AFLLEDIHFE RLCFSSCKTL YVSRHGNYTL FLEDIKPLDL

     151  AYVINTISKG PKISSNGVCL SAPNAGPELK KSLAAIFDNL IAMNRDQKNS

     201  FKFVKLTHYD IEFKEFIQER QRLLSQKAKP SAVDPFFVPN RLGAPSLESQ

     251  NEFNSQLMTL NADEEVPNTS GRKDDPDASS DPIEDSDASS SSSSTGTFLS

     301  SRSYIQSQTP ERKTKVPNNW LDRTSERKKR KLSFTDRTAP SSQLGIDYER

     351  LSLASLGSME TFEGKFVGMY PPEFHSVDDF KHCSLKLYFT PLPLSGPLDR

     401  VLVPSVNCLE IIIPTIERIR ELFGLLNCQS DKISAILLMD KPDLISVEIE

     451  RILWDNDETV SPGLAVWSLK NICADTHVQP PAPRASSPSN PPRLKMRELA

     501  KKDPTIEFRE LGLGAFDTKF VTMFGMLVSC SFDKPAFSSF VFTDFTKNDI

     551  TQNYLYDRYL VDYEAKLDLN EGFKAIMYKN QFEVFDSHIE KIFGKRLKDL

     601  QNGNDENVSQ HGIVCKMNMK VKIYNGKLNA IRARMRTGPV RPGKHPSDAH

     651  AVRAFAVVVP AGIRQTRRVC HLTLFRSVHS VFPHTKKQAP PRGTATRRGQ

     701  TQPRTDTGAD RTSSKRIHPG PERRRVVLRR RVHGHLPAPP LLGPPPTTTA

     751  QEPHALQLRG PRHRHRVPPN TPLFSHHGX

Protein Sequence for WashU_Scas_Contig677.11:

WashU_Scas_Contig677.11  Length: 909  Mon Nov  7 14:59:26 2016  Type: P  Check: 4977  ..

       1  MSESCVFITS PSQFQRFPDS KQISLRFVSL LTGIKYNGKN FILELSDFDN

      51  NNVISPYRVK LRCSDENAKR LAQMTISLLC QFFDFEIPEL RTLSDPFFID

     101  EIQLDRLCFI NCKVIYIGKD DKYSLFLDDI KPIDLNNAIR IARQLQSTLE

     151  QRTILKIFDN LIKLNNESRN GFKFVKLDNY NNEFAQFIQE KQTMVNSRKK

     201  TTIINNNPLF RSHITDTREN EMTSQFDFNS QYLNTENSND STSPSHDSID

     251  PIEESDANSS SIHLSRNTSR QSITTERSPK LRKLNKNSKP VANKPEYYRC

     301  VDIGTICEIQ GKLVGSIPLN LIESNLNASP ARFFFIPNEW TEGKEGNDEA

     351  MIKLLPNYNC IEVLVSKFSE LKGIFSKFTT DFTKLNHFLL NNKVQVRIVR

     401  SKFPFKLLKN DTFHAYNKEH AFAPIWTLQD IDLLPSKIPK KKAVPRLLPS

     451  TIANNQDEDL NKILNQQFER TKNDSVIKFE ELRLSPHEVK FVTMFGLLVS

     501  VTFENSQYVS LVFTDFTTNS IDQKYLFGNY LIDPIVRMNG DQGFRVIMYP

     551  EHFEIFNRNV AKVFGSTLKD LLNGRENITN KGIVCKISLK LKFFTNKLNA

     601  ISRVCIPILT SNNELSLKEY SILDHIYKNA LTNIHEYDMD KCFDSFVKCF

     651  PYKRQADGKI IVTSSTEERE LSLILDDDDD DDDNDNDHQL ETDDNNANLS

     701  SLMNEKSFKE GETQDSIPDI NIDATPYRIQ ENNNIPLLNV LQDDEPVIFR

     751  VSGKLINVEY HPSYLALTIT NDTFAKDAIE WTRILKIEVF SSENIRYFFN

     801  AGVEPPLVEM STQSQVLSTE NAINIEDNLN ILKGFVGKEF SFKITKGTLK

     851  LFTNIGVSVW CPVEYTLEEM KGQMMLRHDR DAKDSKKPLT SSHGMVKQET

     901  HSLVEIID*

Protein Sequence for WashU_Sklu_Contig2236.3:

WashU_Sklu_Contig2236.3  Length: 981  Mon Nov  7 14:59:26 2016  Type: P  Check: 6244  ..

       1  MQANATEYKY IDSPRDLEAY YSNDEIVTHN IRFISVLTSL EFIPNKKCLF

      51  IFQNFEHGRP DECPYTAKIR CDTAETSTLT RMMLSLIAQQ FDLDLPDLDD

     101  PSGFHLRGIY FERLCFVKCQ GRFVSTKNKG SIFLQDIRCI DLNGTLYTAR

     151  TFKESNEITT LNRIFDNLIR LNNDPKNDFK FVKLLNYDHD MKKFIQNRQE

     201  NLALTNFRKN PIFGVNRYLS AQESQDDFDS QRMETQSTLF GFTALGHDNP

     251  TDIQQTHSKH SPPGLSGTLH DTSTEDLIEE SDSSTSEFMA TPVSFRSCRN

     301  NTKNTADPPK VVRPDLTTSN SRHLQSSEES GLPLNPGESN LLFQRNVYTR

     351  ITAMIAEHSK ERESAIARRA SNVVMSQSIP DITPKNGTNQ TDDRALHRSN

     401  FQPEPSTVTS TDTNEQLKKR QKLDIPTLHI AVFPEILSLV HASPNRTFRL

     451  QGKFVGMLPN ELQKKVPQKI STLKLYFQPA SWDEKVLSSK YLNASKNCLE

     501  VVTCNIDQLL DIFSLSKQPD NRSLLGDIST VLLYRTFEVK IQKRRVSMAG

     551  IFYSFCWSLT DISTDSPKKI EEKRSQSSFP VAKGVTPLQH RTYRVDPVKT

     601  VGELSVKKEG EVEFVTIFAL MVAAKINDPY KKRFVFTDFT ANPLTGSYTF

     651  DPFICSYHNR ISSTETLHSV MYDDEYGKFL NRITQCMRCK FEDLFNVKDS

     701  NLTHRGIVCK LGLRVKIYKG KLDGVIRSCI PMMNDSKLTH MERTKLHDFY

     751  TRAIKRIPKV HLDTFYSNFQ KFFPLTINQD GQVELKKSEH DRLLDELYDS

     801  DGAEYASKNV DPEDTSHAEP VEQIIPQLGS YLGDFEVVKN LDIPALNTIE

     851  KLTPKKVYHV QGKVVDITQD DDCLSFLITN DLISEGVLDP TRILKVDIIG

     901  QDNLDYFYNQ RDYKAFQNDL TLLVGKILAF RLSRVLIAVS SKKRLFAWYP

     951  VECTMEEMKS QLQKQLTVSV KQEQIDLTDM *

Protein Sequence for WashU_Skud_Contig1815.8:

WashU_Skud_Contig1815.8  Length: 933  Mon Nov  7 14:59:26 2016  Type: P  Check: 3637  ..

       1  MLEICFYMSS LALQGYGKIH MKMDTLEEPE SSPHRARVFV TSTKEFERYP

      51  SKAIVPVQFV ALLTSIHLTE TKCLLSFSNF MGGEDPVENR YIIKLKFKDR

     101  SSERLARMTI SLLCQYFDIE FPDLDSRSAL VLEDIHLERL CFSSCKALYV

     151  SKHGNYTLFL EDIKPLDRMS VINIISTDSK LSGSNGSLSG PSLKPHLKES

     201  LTDIFNNLIK INKDEKNCFK FVKLIDYDME LKKFIQERQE LLLQESKPKP

     251  VDPFFVPNRM GVPYLESQNE FNSQLMTLNA AESIANTASR REDLNDTADP

     301  IEDSDASTAS STSPFLSSRS YIQTQTPERK ARVPDNWVDR DFEGKKKRKL

     351  SFTTGGTPVD YERLSLAGVG TVERFQGKFV GMYPPEFSSI SEFKRCTLKL

     401  YFTSFLPSSK TPDSVLIPGT NCIEIIIPTT ERIRELFGTL NCQSSKISNI

     451  LLLNKPHPIS VEIEKIMWEN DETIRPGLAV WNLKNINTDT QVKAPAPLSP

     501  LVNPLRTKIR ELANKDPTIE FRELQLNTFE AKYVTMFGML VSCSFDKPAF

     551  ISFVFTDFTK NDIVQNYLYD RYLVDYEAKL ELNEGFKAIM YKNQFEGFDS

     601  GIEKIFAKRL SSLRNGRDEN VSQYGIVCKM NVKVKIYNGK LNAILRDCVP

     651  VPRSQADRIA SPSQCEHLAS FYQRAFDRIG ESAISRYFED YRTFFPIQRN

     701  DSHLAGLKPA VANHRQEREP AELQTAPALN EYIPDLNADV SSFDVEFTDV

     751  FQLLNSLAHR RTRPQQTRKS NTLYSCEGRI IAIEYHPSDI CFHITDGRDP

     801  HRALQLHITS SKNFAYFFNG SNTYLQGHHL EKTHNQLARF LGHPFKFNIT

     851  SSFKSLPGTA MALQIWYPIE CTFRELQQQL AHLMAAATSN SGSLVYGITA

     901  TANPPQLLAA LDGVTVKREE DNDDDAEAVP AS*

Protein Sequence for WashU_Smik_Contig2278.3:

WashU_Smik_Contig2278.3  Length: 586  Mon Nov  7 14:59:26 2016  Type: P  Check: 9816  ..

       1  MDTLEEPECP EHEDRVFVKS SKDFEGYASK AIVPVHFVAL LTSIYLTETK

      51  GLLVFSNFEE GESQVEKDQY IIKLKFKDRS SERLARMTIS LLCQYFDIEL

     101  PDLDSGSTLI LKDIHLERLC FSSCKALYVS RSGNYTLFLE DIKPLDIVNV

     151  INSISTKSQK SGTEFLPSGP IIESNLREPL LDIFNNLIKM NIDERNSFKF

     201  VRLIHYNTEL KKFIQEQQSL LSQKSKTKLI NPFFAPNRLG IPYVETQNEF

     251  NSQLMTLNSE QPITDISSNG DDMRYSTDPI EESDSSTISS TGKFVSPGSC

     301  IQSHTPERKT SVPNNWLDND SEGKNKRRLS FQCTSAPSSQ QIIDYERLSL

     351  AKVGSVERLK GKFVGMYPSH FSGITEFRYC TLKLYFTHLS VSKIPDKILI

     401  PGTNCIEIII PTMERIRELF GVLNCQNSMI SNILLLDKPD PISVEIERVM

     451  WNNDETISPG LTVWSLKNIS VKTQAQASAQ SPAKSLPPVN APRTKMRKMA

     501  EKDPTIEFCH LELNTFETKY VTMFGMLVSC SFDKPAFVSF VFTDFTTNDI

     551  VQNYLYDRYL VDYEAKLELN EGFKAIMYRN QFENIX