Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YDL111C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_RRP42/YDL111C   1   MSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRI   50
MIT_Smik_c184_2815   1   MSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRI   50
MIT_Spar_c103_3358   1   MSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRI   50
MIT_Suva_c961_3571   1   MSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRI   50
WashU_Sbay_Contig561.17   1   MSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRI   50
WashU_Scas_Contig669.17   1   MVLSVAEKSYLYDSLASQPLIRPDGRLHTQFRPIEIFTDFLPSSNGSSRI   50
WashU_Sklu_Contig1742.1   1   MVLSVTEKSYLYESLSSLPPIRPDGRLPHQFRPIEISTDFLPSSNGSSRI   50
Symbols






* ***:******:**:* * ******* ******* *************



SGD_Scer_RRP42/YDL111C   51   IASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLN   100
MIT_Smik_c184_2815   51   IASDGSECIVSIKSKVVDHSVESELIQVDVDIAGQRDDALVVETMTSLLN   100
MIT_Spar_c103_3358   51   IASDGSECIVSIKSKVVDHFVENELLQVDVDIAGQRDDALVVETITSLLN   100
MIT_Suva_c961_3571   51   IASDGSECIVSIKSKVVDHSVENELLQVDVDIAGQRDDALIVETITSLLN   100
WashU_Sbay_Contig561.17   51   IASDGSECIVSIKSKVVDHSVENELLQVDVDIAGQRDDALIVETITSLLN   100
WashU_Scas_Contig669.17   51   IASDGSECIVSIKSKVVDHTVETDLLQVDINIAGERDDSMIVETLTSLLH   100
WashU_Sklu_Contig1742.1   51   IASDGSECIVSIKSKVVDHTVQDELIVVDVDIVGHRDDSSFVTSISSMLS   100
Symbols






******************* *: :*: **::*.*.***: .* :::*:*



SGD_Scer_RRP42/YDL111C   101   KVLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPVSLISFAIYSALN   150
MIT_Smik_c184_2815   101   KVLKSGSGIDSSKLQLTKKYSFKIFVDVLVISSYSHPVSLISFAIYSALN   150
MIT_Spar_c103_3358   101   KVLKSGSGIDSSKLQLTKKYSFKIFVDVLVISSHSHPVSLISFAIYSALN   150
MIT_Suva_c961_3571   101   KVLKSGNGIDSSKLQLTKKYSFKIFVDVLVISSYSYPVSLISFAIYSALN   150
WashU_Sbay_Contig561.17   101   KVLKSGNGIDSSKLQLTKKYSFKIFVDVLVISSYSYPVSLISFAIYSALN   150
WashU_Scas_Contig669.17   101   KVLTSEDGIDVKKLQLTKKYSFKIFVDVLIISTYSYPASLISMGIYCALN   150
WashU_Sklu_Contig1742.1   101   KVLKER--LDLAGLKLTKKYSFKIFIDVLVLSSYSYPLSLTSFAIYSALN   148
Symbols






***.. :* *:**********:***::*::*:* ** *:.**.***



SGD_Scer_RRP42/YDL111C   151   STYLPKLISAFDDLEVEELPTFHDYDMVKLDINPPLVFILAVVGNNMLLD   200
MIT_Smik_c184_2815   151   STYLPKLISAFDDLEVEELPTFHDYDMIKLDINPPLVFILAIVGNNMLLD   200
MIT_Spar_c103_3358   151   STFLPKLISAFDDLEVEELPTFHDYDMVKLDINPPLVFILAIVGNNLLLD   200
MIT_Suva_c961_3571   151   STYLPKLISAFDDLEVEELPTFHDYDMAKLEISPPLVFILAIVGNNILVD   200
WashU_Sbay_Contig561.17   151   STYLPKLISAFDDLEVEELPTFHDYDMAKLEISPPLVFILAIVGNNILVD   200
WashU_Scas_Contig669.17   151   STWLPKIISAFDDLEVAELPTFHDYDLVKLDVKSPLIFVLAIVGDNIFLD   200
WashU_Sklu_Contig1742.1   149   STYLPKLISSDDDLEVEELPTFHDYDLVKLNTEAPLLFTVALVGDNILVD   198
Symbols






**:***:**: ***** *********: **: ..**:* :*:**:*:::*



SGD_Scer_RRP42/YDL111C   201   PAANESEVANNGLIISWS--NGKITSPIRSVALNDSNVKSFKPHLLKQGL   248
MIT_Smik_c184_2815   201   PAANESEVANNGLIITWS--NGKITSPIRSIALNDSNVKGLKPNLLKQGF   248
MIT_Spar_c103_3358   201   PAANESEVANSGLIISWS--NGKITTPIRSVALNDSNVKGFKPHLLKQGL   248
MIT_Suva_c961_3571   201   PAANESEVANNGLIVTWS--NGKITSPIRSVALNDSNVKGFKPHLLKQGL   248
WashU_Sbay_Contig561.17   201   PAANESEVANNGLIVTWS--NGKITSPIRSVALNDSNVKGFKPHLLKQGL   248
WashU_Scas_Contig669.17   201   PASNESEVANNGLIITWSPQGGKVISPVKTIALNDTFIKGFNPILLKKGI   250
WashU_Sklu_Contig1742.1   199   PASNESDVANNGLVLTWN--NGKVTSPIRSINLNDDYVKGFNTDHLQKSI   246
Symbols






**:***:***.**:::*. .**: :*:::: *** :*.::. *::.:



SGD_Scer_RRP42/YDL111C   249   AMVEKYAPDVVRSLENL   265
MIT_Smik_c184_2815   249   AMVEKYASDVVRSLENL   265
MIT_Spar_c103_3358   249   AMVEKYAPDVVRSLENL   265
MIT_Suva_c961_3571   249   AMVEKYASDIVRSLENL   265
WashU_Sbay_Contig561.17   249   AMVEKYASDIVRSLENL   265
WashU_Scas_Contig669.17   251   KLVEENASSVAQALETL   267
WashU_Sklu_Contig1742.1   247   QIIQEYAPKVVEALNSM   263
Symbols






:::: *..:..:*:.:



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_RRP42/YDL111C:

SGD_Scer_RRP42/YDL111C  Length: 266  Mon Nov  7 14:56:58 2016  Type: P  Check: 2443  ..

       1  MSLSVAEKSY LYDSLASTPS IRPDGRLPHQ FRPIEIFTDF LPSSNGSSRI

      51  IASDGSECIV SIKSKVVDHH VENELLQVDV DIAGQRDDAL VVETITSLLN

     101  KVLKSGSGVD SSKLQLTKKY SFKIFVDVLV ISSHSHPVSL ISFAIYSALN

     151  STYLPKLISA FDDLEVEELP TFHDYDMVKL DINPPLVFIL AVVGNNMLLD

     201  PAANESEVAN NGLIISWSNG KITSPIRSVA LNDSNVKSFK PHLLKQGLAM

     251  VEKYAPDVVR SLENL*

Protein Sequence for MIT_Smik_c184_2815:

MIT_Smik_c184_2815  Length: 266  Mon Nov  7 14:56:58 2016  Type: P  Check: 2087  ..

       1  MSLSVAEKSY LYDSLASTPS IRPDGRLPHQ FRPIEIFTDF LPSSNGSSRI

      51  IASDGSECIV SIKSKVVDHS VESELIQVDV DIAGQRDDAL VVETMTSLLN

     101  KVLKSGSGID SSKLQLTKKY SFKIFVDVLV ISSYSHPVSL ISFAIYSALN

     151  STYLPKLISA FDDLEVEELP TFHDYDMIKL DINPPLVFIL AIVGNNMLLD

     201  PAANESEVAN NGLIITWSNG KITSPIRSIA LNDSNVKGLK PNLLKQGFAM

     251  VEKYASDVVR SLENL*

Protein Sequence for MIT_Spar_c103_3358:

MIT_Spar_c103_3358  Length: 266  Mon Nov  7 14:56:58 2016  Type: P  Check: 834  ..

       1  MSLSVAEKSY LYDSLASTPS IRPDGRLPHQ FRPIEIFTDF LPSSNGSSRI

      51  IASDGSECIV SIKSKVVDHF VENELLQVDV DIAGQRDDAL VVETITSLLN

     101  KVLKSGSGID SSKLQLTKKY SFKIFVDVLV ISSHSHPVSL ISFAIYSALN

     151  STFLPKLISA FDDLEVEELP TFHDYDMVKL DINPPLVFIL AIVGNNLLLD

     201  PAANESEVAN SGLIISWSNG KITTPIRSVA LNDSNVKGFK PHLLKQGLAM

     251  VEKYAPDVVR SLENL*

Protein Sequence for MIT_Suva_c961_3571:

MIT_Suva_c961_3571  Length: 266  Mon Nov  7 14:56:58 2016  Type: P  Check: 1949  ..

       1  MSLSVAEKSY LYDSLASTPS IRPDGRLPHQ FRPIEIFTDF LPSSNGSSRI

      51  IASDGSECIV SIKSKVVDHS VENELLQVDV DIAGQRDDAL IVETITSLLN

     101  KVLKSGNGID SSKLQLTKKY SFKIFVDVLV ISSYSYPVSL ISFAIYSALN

     151  STYLPKLISA FDDLEVEELP TFHDYDMAKL EISPPLVFIL AIVGNNILVD

     201  PAANESEVAN NGLIVTWSNG KITSPIRSVA LNDSNVKGFK PHLLKQGLAM

     251  VEKYASDIVR SLENL*

Protein Sequence for WashU_Sbay_Contig561.17:

WashU_Sbay_Contig561.17  Length: 266  Mon Nov  7 14:56:58 2016  Type: P  Check: 1949  ..

       1  MSLSVAEKSY LYDSLASTPS IRPDGRLPHQ FRPIEIFTDF LPSSNGSSRI

      51  IASDGSECIV SIKSKVVDHS VENELLQVDV DIAGQRDDAL IVETITSLLN

     101  KVLKSGNGID SSKLQLTKKY SFKIFVDVLV ISSYSYPVSL ISFAIYSALN

     151  STYLPKLISA FDDLEVEELP TFHDYDMAKL EISPPLVFIL AIVGNNILVD

     201  PAANESEVAN NGLIVTWSNG KITSPIRSVA LNDSNVKGFK PHLLKQGLAM

     251  VEKYASDIVR SLENL*

Protein Sequence for WashU_Scas_Contig669.17:

WashU_Scas_Contig669.17  Length: 268  Mon Nov  7 14:56:58 2016  Type: P  Check: 5198  ..

       1  MVLSVAEKSY LYDSLASQPL IRPDGRLHTQ FRPIEIFTDF LPSSNGSSRI

      51  IASDGSECIV SIKSKVVDHT VETDLLQVDI NIAGERDDSM IVETLTSLLH

     101  KVLTSEDGID VKKLQLTKKY SFKIFVDVLI ISTYSYPASL ISMGIYCALN

     151  STWLPKIISA FDDLEVAELP TFHDYDLVKL DVKSPLIFVL AIVGDNIFLD

     201  PASNESEVAN NGLIITWSPQ GGKVISPVKT IALNDTFIKG FNPILLKKGI

     251  KLVEENASSV AQALETL*

Protein Sequence for WashU_Sklu_Contig1742.1:

WashU_Sklu_Contig1742.1  Length: 264  Mon Nov  7 14:56:58 2016  Type: P  Check: 8487  ..

       1  MVLSVTEKSY LYESLSSLPP IRPDGRLPHQ FRPIEISTDF LPSSNGSSRI

      51  IASDGSECIV SIKSKVVDHT VQDELIVVDV DIVGHRDDSS FVTSISSMLS

     101  KVLKERLDLA GLKLTKKYSF KIFIDVLVLS SYSYPLSLTS FAIYSALNST

     151  YLPKLISSDD DLEVEELPTF HDYDLVKLNT EAPLLFTVAL VGDNILVDPA

     201  SNESDVANNG LVLTWNNGKV TSPIRSINLN DDYVKGFNTD HLQKSIQIIQ

     251  EYAPKVVEAL NSM*