Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YDL020C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_RPN4/YDL020C   1   MASTELSLKRTLTDILEDELYHTNPGHSQFTSHYQNYHPNASITPYKLVN   50
MIT_Smik_c710_3158   1   MASTELGLKRTLTDILEDELYHTNPVHNQFAGHYQNYHPNASITPYKLVN   50
MIT_Spar_c96_3679   1   MASTELSLKRTLTDILEDELYHTNPSHNQFAGHYQNYHPNASITPYKLVN   50
MIT_Suva_c621_3988   1   MASTELSLKRTLTDILEDELYHTNPAHNQFAGHYQNYHPNASITPYKLVN   50
WashU_Sbay_Contig542.4   1   MASTELSLKRTLTDILEDELYHTNPAHNQFAGHYQNYHPNASITPYKLVN   50
WashU_Scas_Contig718.67   1   MASTDLFLRRTLTDVLEDELYHLNSDCYQDTSVYPTYYNAAQLPLKERLC   50
WashU_Skud_Contig1867.8   1   MASTELSLKRTLTDILEDELYHTSPAHNQFPGHYQNYHPNSSITPYKLVN   50
Symbols






****:* *:*****:******* .. * .. * .*: :.:. : :



SGD_Scer_RPN4/YDL020C   51   KNKENNTFTWNHSLQHQNESSAASIPPQQTYHFPIFNKYADPTLTTTTSF   100
MIT_Smik_c710_3158   51   NNKENNSFTWSHSPYQQNESSVASIPPQQTYHFPIFNKYADPTLTTTTTF   100
MIT_Spar_c96_3679   51   GNKENNGFTWNHSSQQQNESSAASIPPQQTFHFPIFNKYADPTLTTTTSF   100
MIT_Suva_c621_3988   51   SNKENNNFTWNAPFQQQNESNTASLPPQQTYHFPIFNKYADPTLTTTTSL   100
WashU_Sbay_Contig542.4   51   SNKENNNFTWNAPFQQQNESNTASLPPQQTYHFPIFNKYADPTLTTTTSL   100
WashU_Scas_Contig718.67   51   NSQLSLCSPSSSSNTQAN--------------------------TSTNSP   74
WashU_Skud_Contig1867.8   51   NSKESNGFTWNHSYQQQNESSAPSIPPQQTYHFPIFNKYADPTLTTTTSF   100
Symbols






.: . . . . : * *:*.:



SGD_Scer_RPN4/YDL020C   101   TTSEATANDRQIN--NVHLIPNEIKGASETPLQKTVNLKNIMKVSDPYVP   148
MIT_Smik_c710_3158   101   TNGDTTANDRQIS--NVHLIPNEIKNVNETPLQKTVNLKNIMKVSDPYVP   148
MIT_Spar_c96_3679   101   TNGEGPANDKQIN--NVHLIPNEVKSVSETPLQKTVNLKNIMKVSDPYVP   148
MIT_Suva_c621_3988   101   TNGEAAANDKQVVGNNVHLIPNESKAANETPLQKTVDLKNIMKVSDPYVP   150
WashU_Sbay_Contig542.4   101   TNGEAAANDKQVVGNNVHLIPNESKAANETPLQKTVDLKNIMKVSDPYVP   150
WashU_Scas_Contig718.67   75   AASVIANNENPTSYFNVNLQ----------------DLNMFSKYADPSLT   108
WashU_Skud_Contig1867.8   101   TSGEATTNDRQIN--NVHLIPNEAKTAAETPLQKTVNLKNVMKVSDPYVP   148
Symbols






: . . *:. **:* :*: . * :** :.



SGD_Scer_RPN4/YDL020C   149   TRNTFNYDVKISNDFFDNGDNLYGNDEEVLFYEDNYNPKMQWSLQDNSAA   198
MIT_Smik_c710_3158   149   TRNTFNYDVKISNDFFDNGDNLYGNDEEVLFYEDNYNPKMQWSLQDNTTA   198
MIT_Spar_c96_3679   149   TRNTFNYDVKISNDFFDNGDNLYGNDEEVLFYEDNYNPKMQWSLQDNSAA   198
MIT_Suva_c621_3988   151   TRNTFNYDVKISNDFFDNGDNLYGNDEEVLFYEDNYNPKMQWSLQDNNVA   200
WashU_Sbay_Contig542.4   151   TRNTFNYDVKISNDFFDNGDNLYGNDEEVLFYEDNYNPKMQWSLQDNNVA   200
WashU_Scas_Contig718.67   109   TTTTKDKEREKKNNINKLNFHIQRNHRNLLAKVKTINLRSIQKEPRP---   155
WashU_Skud_Contig1867.8   149   TRNIFNYDVKISNDFFDNGDNLYGNDEEVLFYEDNYNPKMQWSLQDNSAA   198
Symbols






* . : : : .*:: . . :: *..::* .. * : .



SGD_Scer_RPN4/YDL020C   199   INNEDARAIFNNEFDSDDDDISDDEEDEIEEN-------------CLQQE   235
MIT_Smik_c710_3158   199   INNDDARAIFNNEFDSDDDDISDDEEDDIEEGEEEEKDDTVEKEYRFQQS   248
MIT_Spar_c96_3679   199   INNEDARAIFNNEFDSDDDDISDDEEDEIEEED------------CLQQD   236
MIT_Suva_c621_3988   201   INNEDARTIFNNEFDSDDDDISDDEEDEIEEEDR---------------L   235
WashU_Sbay_Contig542.4   201   INNEDARTIFNNEFDSDDDDISDDEEDEIEEEDR---------------L   235
WashU_Scas_Contig718.67   156   --NESAPFVSNIINGPVTSSVEEPIKMSTEVFDN---------------I   188
WashU_Skud_Contig1867.8   199   INNEDARAIFNNEFDSDDDDISDDEEDEIEEEEG-----------LQQQQ   237
Symbols






*:.* : * .. ..:.: : . *



SGD_Scer_RPN4/YDL020C   236   QHQEEPLLSLDVTPISMFGSDQKTGRAKSSSHLFNEYSYVDSNMDSISSV   285
MIT_Smik_c710_3158   249   QQQEEPLLPLDSTPITIFVSDQKTGRARSTGHLFNEYSYVDSNIDNMTNI   298
MIT_Spar_c96_3679   237   QHQEEPLLPLDATSISIFGADQKMGRAKSTGHLFNEYSYVDSNIDSMTSG   286
MIT_Suva_c621_3988   236   QKQEEILLPLDVTPVSIFGTDHKMNHIKSAGHVFNEYSYVDSNTDDITNT   285
WashU_Sbay_Contig542.4   236   QKQEEILLPLDVTPVSIFGTDHKMNHIKSAGHVFNEYSYVDSNTDDITNT   285
WashU_Scas_Contig718.67   189   YKDINVTTPDSDNTFSMNETNQDLDFLDTIDETKFDWPLRDNTLKGTDTK   238
WashU_Skud_Contig1867.8   238   QQQQETLLPLDDVPTSIFCTDQKMGRTKSTGHLFNEYSYVDSNIDGMTTV   287
Symbols






:: : . . . :: :::. . : .. ::. *.. .. .



SGD_Scer_RPN4/YDL020C   286   VSEDLLDER--GHEKIEDEDEDND---LDEDDIYDISLLKNRRKQSFVLN   330
MIT_Smik_c710_3158   299   VSENLLDEQEHGNEGEDEDEGEDDNDLLEGDDIYDISLLKNRRKQSFVLN   348
MIT_Spar_c96_3679   287   VSKNLLDEQ--GHEKIQDEDEDEDNDLLDEDHIYDISLLKNRRKQSFVLN   334
MIT_Suva_c621_3988   286   TPKNTLDEQENGNAEEGEE--EEDNDLLDEDDLYDISLLKNKRKQSFVLN   333
WashU_Sbay_Contig542.4   286   TPKNTLDEQENGNAEEGEE--EEDNDLLDEDDLYDISLLKNKRKQSFVLN   333
WashU_Scas_Contig718.67   239   VIF----------DNEFKEEMDEDEEDSDLDDDMELSPLSESDFKSSQLV   278
WashU_Skud_Contig1867.8   288   MSENVLDKQGHGNDEEEEENEEEDND-LDEDDIYDISLLKNRRKQSFVLN   336
Symbols






.: ::* : *. ::* *.: :* *



SGD_Scer_RPN4/YDL020C   331   KNTIDFERFPSPSTSANVPSTATTGKRKPAKSSSNRSCVSNSNENGTLER   380
MIT_Smik_c710_3158   349   KNTIDFERFPSPSTSENIPSTTVTSKRKPTKSSNNRNGVNSNSENATLEK   398
MIT_Spar_c96_3679   335   KNTIDFERFPSPSTSANKPSNAAAGKRKPAKSSNNRSGANNNNENSSLER   384
MIT_Suva_c621_3988   334   KNTIDFERLSSPSTPVKVPSNTATTRRKSTKSFNNSGGTNSNNENTMVEK   383
WashU_Sbay_Contig542.4   334   KNTIDFERLSSPSTPVKVPSNTATTRRKSTKSFNNSGGTNSNNENTMVEK   383
WashU_Scas_Contig718.67   279   DNENTYHHQSMIPTPLTSENSSPRESLKPVITLPSSSSTSNKPISNLKLN   328
WashU_Skud_Contig1867.8   337   KNTIDFERFSSPSTSTSIPS--NATKRKLTKSSTNRSAINSNNENSIVER   384
Symbols






.* :.: . .*. . . * . : . . ... . .



SGD_Scer_RPN4/YDL020C   381   IKKPTSAVVSSNASRRKLINYTKKHLSSHSS-TNSNSKPSTASP-SAHTS   428
MIT_Smik_c710_3158   399   IKKPTPAVSGSHTSRRKLINYTKKHLSSQSLSSSSNLKTSTTSP-SVHTT   447
MIT_Spar_c96_3679   385   IKKPTSAVLTSNTSRRKLINYTKKHLSSHSSSSNSNSKSSTTPP-SAHAS   433
MIT_Suva_c621_3988   384   IKKPTSSVSSSNTSRRKLINYTKKHLSSHPTPFSSNPGSTTTSP-SAHAS   432
WashU_Sbay_Contig542.4   384   IKKPTSSVSSSNTSRRKLINYTKKHLSSHPTPFSSNPGSTTTSP-SAHAS   432
WashU_Scas_Contig718.67   329   IPKDFTMKSNEEKRKESLIEELRK--------SSYSIKKPASIEESLKAI   370
WashU_Skud_Contig1867.8   385   IKKPTSIVSNSNTNRRKLINYTKKHLSSHSSPSNSNSKSTTTSSSSAHAS   434
Symbols






* * . .. :..**: :* . . .:: * ::



SGD_Scer_RPN4/YDL020C   429   SSDGNNEIFTCQIMNLITNEPCGAQFSRSYDLTRHQNTIHAKRKIVFRCS   478
MIT_Smik_c710_3158   448   SSDTNNEIYTCQIMNLITNEPCGAQFSRSYDLTRHQNTIHAKRKIVFRCS   497
MIT_Spar_c96_3679   434   SSDGNNEIFTCQIMNLITNEPCGAQFSRSYDLTRHQNTIHAKRKIVFRCS   483
MIT_Suva_c621_3988   433   SSDGSNEIFTCQIMNLISNEPCGAQFSRSYDLTRHQNTIHAKRKIVFRCS   482
WashU_Sbay_Contig542.4   433   SSDGSNEIFTCQIMNLISNEPCGAQFSRSYDLTRHQNTIHAKRKIVFRCS   482
WashU_Scas_Contig718.67   371   TESSTDETYTCRIINLTTNEPCCAQFSRSYDLTRHQNTIHASKKTVFRCS   420
WashU_Skud_Contig1867.8   435   SSDGTSEIFSCQIMNLITNEPCGAQFSRSYDLTRHQNTIHAKRKIVFRCS   484
Symbols






:.. ..* ::*:*:** :**** ******************.:* *****



SGD_Scer_RPN4/YDL020C   479   ECIKILGSEGYQKTFSRLDALTRHIKSKHEDLSLEQRQEVTKFAKANIGY   528
MIT_Smik_c710_3158   498   ECIKILGSEGYQKTFSRLDALTRHIKSKHEDLSIEERQEVTKFAKANIGY   547
MIT_Spar_c96_3679   484   ECIKILGSEGYQKTFSRLDALTRHIKSKHEDLSLEQRQEVTKFAKANIGY   533
MIT_Suva_c621_3988   483   ECIKILGSEGYQKTFSRLDALTRHIKSKHEDLSLEQRQEVTKFAKANIGY   532
WashU_Sbay_Contig542.4   483   ECIKILGSEGYQKTFSRLDALTRHIKSKHEDLSLEQRQEVTKFAKANIGY   532
WashU_Scas_Contig718.67   421   ECIKSLGNEGYDKTFSRLDALTRHIKSKHDDLSTIERKQVTKFAKENIGY   470
WashU_Skud_Contig1867.8   485   ECIKILGSEGYQKTFSRLDALTRHIKSKHEDLSLEQRQEVTKFAKANIGY   534
Symbols






**** **.***:*****************:*** :*::****** ****



SGD_Scer_RPN4/YDL020C   529   VMG   531
MIT_Smik_c710_3158   548   VMG   550
MIT_Spar_c96_3679   534   VMG   536
MIT_Suva_c621_3988   533   VMG   535
WashU_Sbay_Contig542.4   533   VMG   535
WashU_Scas_Contig718.67   471   VIG   473
WashU_Skud_Contig1867.8   535   VMG   537
Symbols






*:*



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_RPN4/YDL020C:

SGD_Scer_RPN4/YDL020C  Length: 532  Mon Nov  7 14:55:07 2016  Type: P  Check: 2587  ..

       1  MASTELSLKR TLTDILEDEL YHTNPGHSQF TSHYQNYHPN ASITPYKLVN

      51  KNKENNTFTW NHSLQHQNES SAASIPPQQT YHFPIFNKYA DPTLTTTTSF

     101  TTSEATANDR QINNVHLIPN EIKGASETPL QKTVNLKNIM KVSDPYVPTR

     151  NTFNYDVKIS NDFFDNGDNL YGNDEEVLFY EDNYNPKMQW SLQDNSAAIN

     201  NEDARAIFNN EFDSDDDDIS DDEEDEIEEN CLQQEQHQEE PLLSLDVTPI

     251  SMFGSDQKTG RAKSSSHLFN EYSYVDSNMD SISSVVSEDL LDERGHEKIE

     301  DEDEDNDLDE DDIYDISLLK NRRKQSFVLN KNTIDFERFP SPSTSANVPS

     351  TATTGKRKPA KSSSNRSCVS NSNENGTLER IKKPTSAVVS SNASRRKLIN

     401  YTKKHLSSHS STNSNSKPST ASPSAHTSSS DGNNEIFTCQ IMNLITNEPC

     451  GAQFSRSYDL TRHQNTIHAK RKIVFRCSEC IKILGSEGYQ KTFSRLDALT

     501  RHIKSKHEDL SLEQRQEVTK FAKANIGYVM G*

Protein Sequence for MIT_Smik_c710_3158:

MIT_Smik_c710_3158  Length: 551  Mon Nov  7 14:55:07 2016  Type: P  Check: 7219  ..

       1  MASTELGLKR TLTDILEDEL YHTNPVHNQF AGHYQNYHPN ASITPYKLVN

      51  NNKENNSFTW SHSPYQQNES SVASIPPQQT YHFPIFNKYA DPTLTTTTTF

     101  TNGDTTANDR QISNVHLIPN EIKNVNETPL QKTVNLKNIM KVSDPYVPTR

     151  NTFNYDVKIS NDFFDNGDNL YGNDEEVLFY EDNYNPKMQW SLQDNTTAIN

     201  NDDARAIFNN EFDSDDDDIS DDEEDDIEEG EEEEKDDTVE KEYRFQQSQQ

     251  QEEPLLPLDS TPITIFVSDQ KTGRARSTGH LFNEYSYVDS NIDNMTNIVS

     301  ENLLDEQEHG NEGEDEDEGE DDNDLLEGDD IYDISLLKNR RKQSFVLNKN

     351  TIDFERFPSP STSENIPSTT VTSKRKPTKS SNNRNGVNSN SENATLEKIK

     401  KPTPAVSGSH TSRRKLINYT KKHLSSQSLS SSSNLKTSTT SPSVHTTSSD

     451  TNNEIYTCQI MNLITNEPCG AQFSRSYDLT RHQNTIHAKR KIVFRCSECI

     501  KILGSEGYQK TFSRLDALTR HIKSKHEDLS IEERQEVTKF AKANIGYVMG

     551  *

Protein Sequence for MIT_Spar_c96_3679:

MIT_Spar_c96_3679  Length: 537  Mon Nov  7 14:55:07 2016  Type: P  Check: 5786  ..

       1  MASTELSLKR TLTDILEDEL YHTNPSHNQF AGHYQNYHPN ASITPYKLVN

      51  GNKENNGFTW NHSSQQQNES SAASIPPQQT FHFPIFNKYA DPTLTTTTSF

     101  TNGEGPANDK QINNVHLIPN EVKSVSETPL QKTVNLKNIM KVSDPYVPTR

     151  NTFNYDVKIS NDFFDNGDNL YGNDEEVLFY EDNYNPKMQW SLQDNSAAIN

     201  NEDARAIFNN EFDSDDDDIS DDEEDEIEEE DCLQQDQHQE EPLLPLDATS

     251  ISIFGADQKM GRAKSTGHLF NEYSYVDSNI DSMTSGVSKN LLDEQGHEKI

     301  QDEDEDEDND LLDEDHIYDI SLLKNRRKQS FVLNKNTIDF ERFPSPSTSA

     351  NKPSNAAAGK RKPAKSSNNR SGANNNNENS SLERIKKPTS AVLTSNTSRR

     401  KLINYTKKHL SSHSSSSNSN SKSSTTPPSA HASSSDGNNE IFTCQIMNLI

     451  TNEPCGAQFS RSYDLTRHQN TIHAKRKIVF RCSECIKILG SEGYQKTFSR

     501  LDALTRHIKS KHEDLSLEQR QEVTKFAKAN IGYVMG*

Protein Sequence for MIT_Suva_c621_3988:

MIT_Suva_c621_3988  Length: 536  Mon Nov  7 14:55:07 2016  Type: P  Check: 7074  ..

       1  MASTELSLKR TLTDILEDEL YHTNPAHNQF AGHYQNYHPN ASITPYKLVN

      51  SNKENNNFTW NAPFQQQNES NTASLPPQQT YHFPIFNKYA DPTLTTTTSL

     101  TNGEAAANDK QVVGNNVHLI PNESKAANET PLQKTVDLKN IMKVSDPYVP

     151  TRNTFNYDVK ISNDFFDNGD NLYGNDEEVL FYEDNYNPKM QWSLQDNNVA

     201  INNEDARTIF NNEFDSDDDD ISDDEEDEIE EEDRLQKQEE ILLPLDVTPV

     251  SIFGTDHKMN HIKSAGHVFN EYSYVDSNTD DITNTTPKNT LDEQENGNAE

     301  EGEEEEDNDL LDEDDLYDIS LLKNKRKQSF VLNKNTIDFE RLSSPSTPVK

     351  VPSNTATTRR KSTKSFNNSG GTNSNNENTM VEKIKKPTSS VSSSNTSRRK

     401  LINYTKKHLS SHPTPFSSNP GSTTTSPSAH ASSSDGSNEI FTCQIMNLIS

     451  NEPCGAQFSR SYDLTRHQNT IHAKRKIVFR CSECIKILGS EGYQKTFSRL

     501  DALTRHIKSK HEDLSLEQRQ EVTKFAKANI GYVMG*

Protein Sequence for WashU_Sbay_Contig542.4:

WashU_Sbay_Contig542.4  Length: 536  Mon Nov  7 14:55:07 2016  Type: P  Check: 7074  ..

       1  MASTELSLKR TLTDILEDEL YHTNPAHNQF AGHYQNYHPN ASITPYKLVN

      51  SNKENNNFTW NAPFQQQNES NTASLPPQQT YHFPIFNKYA DPTLTTTTSL

     101  TNGEAAANDK QVVGNNVHLI PNESKAANET PLQKTVDLKN IMKVSDPYVP

     151  TRNTFNYDVK ISNDFFDNGD NLYGNDEEVL FYEDNYNPKM QWSLQDNNVA

     201  INNEDARTIF NNEFDSDDDD ISDDEEDEIE EEDRLQKQEE ILLPLDVTPV

     251  SIFGTDHKMN HIKSAGHVFN EYSYVDSNTD DITNTTPKNT LDEQENGNAE

     301  EGEEEEDNDL LDEDDLYDIS LLKNKRKQSF VLNKNTIDFE RLSSPSTPVK

     351  VPSNTATTRR KSTKSFNNSG GTNSNNENTM VEKIKKPTSS VSSSNTSRRK

     401  LINYTKKHLS SHPTPFSSNP GSTTTSPSAH ASSSDGSNEI FTCQIMNLIS

     451  NEPCGAQFSR SYDLTRHQNT IHAKRKIVFR CSECIKILGS EGYQKTFSRL

     501  DALTRHIKSK HEDLSLEQRQ EVTKFAKANI GYVMG*

Protein Sequence for WashU_Scas_Contig718.67:

WashU_Scas_Contig718.67  Length: 474  Mon Nov  7 14:55:07 2016  Type: P  Check: 7622  ..

       1  MASTDLFLRR TLTDVLEDEL YHLNSDCYQD TSVYPTYYNA AQLPLKERLC

      51  NSQLSLCSPS SSSNTQANTS TNSPAASVIA NNENPTSYFN VNLQDLNMFS

     101  KYADPSLTTT TTKDKEREKK NNINKLNFHI QRNHRNLLAK VKTINLRSIQ

     151  KEPRPNESAP FVSNIINGPV TSSVEEPIKM STEVFDNIYK DINVTTPDSD

     201  NTFSMNETNQ DLDFLDTIDE TKFDWPLRDN TLKGTDTKVI FDNEFKEEMD

     251  EDEEDSDLDD DMELSPLSES DFKSSQLVDN ENTYHHQSMI PTPLTSENSS

     301  PRESLKPVIT LPSSSSTSNK PISNLKLNIP KDFTMKSNEE KRKESLIEEL

     351  RKSSYSIKKP ASIEESLKAI TESSTDETYT CRIINLTTNE PCCAQFSRSY

     401  DLTRHQNTIH ASKKTVFRCS ECIKSLGNEG YDKTFSRLDA LTRHIKSKHD

     451  DLSTIERKQV TKFAKENIGY VIG*

Protein Sequence for WashU_Skud_Contig1867.8:

WashU_Skud_Contig1867.8  Length: 538  Mon Nov  7 14:55:07 2016  Type: P  Check: 4541  ..

       1  MASTELSLKR TLTDILEDEL YHTSPAHNQF PGHYQNYHPN SSITPYKLVN

      51  NSKESNGFTW NHSYQQQNES SAPSIPPQQT YHFPIFNKYA DPTLTTTTSF

     101  TSGEATTNDR QINNVHLIPN EAKTAAETPL QKTVNLKNVM KVSDPYVPTR

     151  NIFNYDVKIS NDFFDNGDNL YGNDEEVLFY EDNYNPKMQW SLQDNSAAIN

     201  NEDARAIFNN EFDSDDDDIS DDEEDEIEEE EGLQQQQQQQ QETLLPLDDV

     251  PTSIFCTDQK MGRTKSTGHL FNEYSYVDSN IDGMTTVMSE NVLDKQGHGN

     301  DEEEEENEEE DNDLDEDDIY DISLLKNRRK QSFVLNKNTI DFERFSSPST

     351  STSIPSNATK RKLTKSSTNR SAINSNNENS IVERIKKPTS IVSNSNTNRR

     401  KLINYTKKHL SSHSSPSNSN SKSTTTSSSS AHASSSDGTS EIFSCQIMNL

     451  ITNEPCGAQF SRSYDLTRHQ NTIHAKRKIV FRCSECIKIL GSEGYQKTFS

     501  RLDALTRHIK SKHEDLSLEQ RQEVTKFAKA NIGYVMG*