Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YDL003W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_MCD1/YDL003W   1   MVTENPQRLTVLRLATNKGPLAQIWLASNMSNIPRGSVIQTHIAESAKEI   50
MIT_Smik_c716_3220   1   MATENSQRLTVLKLATNKGPLAQIWLASNMSNIPRGSIIQTHIAESAKEI   50
MIT_Spar_c96_3731   1   MVTENPQRLTVLRLATNKGPLAQIWLASNMSNIPRGSVIQTHIAESAKEI   50
MIT_Suva_c99_600   1   -----------------------------MSNISRGSAIQTHIAESAKEI   21
WashU_Sbay_Contig611.6   1   MATENPQRLTVLKLATNKGPLAQIWLASNMSNISRGSAIQTHIAESAKEI   50
WashU_Sklu_Contig1584.2   
   --------------------------------------------------   
WashU_Skud_Contig1672.5   1   MTTENPQRLTVLKLATNKGPLAQIWLASNMSNISRGSVIQTHIAESAKEI   50
WashU_Smik_Contig2486.2   1   MATENSQRLTVLKLATNKGPLAQIWLASNMSNIPRGSIIQTHIAESAKEI   50
Symbols










SGD_Scer_MCD1/YDL003W   51   AKASGCDDESGDNEYITLRTSGELLQGIVRVYSKQATFLLTDIKDTLTKI   100
MIT_Smik_c716_3220   51   AKASGCDDESREIEHITLRTSAELLQGIVRVYSKQATFLLTDIKDTLTKI   100
MIT_Spar_c96_3731   51   AKASGCDDESGDNEYITLRTSGELLQGIVRVYSKQATFLLTDIKDTLTKI   100
MIT_Suva_c99_600   22   AKASGYGDENESVKHITLRTSGELLQGIVRVYSKQATFLLTDIKDTLTKI   71
WashU_Sbay_Contig611.6   51   AKASGYGDENESVEHITLRTSGELLQGIVRVYSKQATFLLTDIKDTLTKI   100
WashU_Sklu_Contig1584.2   
   --------------------------------------------------   
WashU_Skud_Contig1672.5   51   AKASGCGDETESTEHITLRTSGELLQGIVRVYSKQATFLLTDIKDTLTKI   100
WashU_Smik_Contig2486.2   51   AKASGCDDESREIEHITLRTSAELLQGIVRVYSKQATFLLTDIKDTLTKI   100
Symbols










SGD_Scer_MCD1/YDL003W   101   SMLFKTSQKMTSTVNRLNTVTRVHQLMLEDAVTEREVLVTPGLEFLDDTT   150
MIT_Smik_c716_3220   101   SMLFKTNQRMNATVSRLNTITRVHQLMLEDAVTEREVLVTPGLEFLDDTT   150
MIT_Spar_c96_3731   101   SMLFRTNQKMNTTVSRLNTVTRVHQLMLEDAVTEREVLVTPGLEFLDDTT   150
MIT_Suva_c99_600   72   STLFKTNQGVHVTVSRLNTVTRVDQLILEDAVTEREVLVTPGLEFLDDTT   121
WashU_Sbay_Contig611.6   101   STLFKTNQGVHVTVSRLNTVTRVDQLILEDAVTEREVLVTPGLEFLDDTT   150
WashU_Sklu_Contig1584.2   
   --------------------------------------------------   
WashU_Skud_Contig1672.5   101   STLFKTNQKINTTVSRLNTVTRVHQLMLEDAVTEREVLVTPGLEFLDDTT   150
WashU_Smik_Contig2486.2   101   SMLFKTNQRMNATVSRLNTITRVHQLMLEDAVTEREVLVTPGLEFLDDTT   150
Symbols










SGD_Scer_MCD1/YDL003W   151   IPVGLMAQENSMERKVQGAAPWDTSLEVGRRFSPDEDFEHNNLSSMNLDF   200
MIT_Smik_c716_3220   151   IPVGLMAQENSMERKVQGATPWDTSLEVGRRFSPDEDFGHNSISGMDLDF   200
MIT_Spar_c96_3731   151   IPAGLMAQENSMERKVQGAAPWDTSLEVGRRFSPDEDFEHN-LSGMDLDF   199
MIT_Suva_c99_600   122   IPVGLMAQENSMERKVQGAAPWDTSLEVGRRFNPDEDLEHNHMSSMDLDF   171
WashU_Sbay_Contig611.6   151   IPVGLMAQENSMERKVQGAAPWDTSLEVGRRFNPDEDLEHNHMSSMDLDF   200
WashU_Sklu_Contig1584.2   1   -----MGGEQSMERHVQGAAAMDRSLELGRRFAPDDDLEQH--STLDLNF   43
WashU_Skud_Contig1672.5   151   IPVGLMAQENSMERKVQGAAPWDTSLEVGRRFNPDEDFEHN-VSGMDLDF   199
WashU_Smik_Contig2486.2   151   IPAGLMAQENSMERKVQGATPWDTSLEVGRRFSPDEDFGHNSISGMDLDF   200
Symbols






*. *:****:****:. * ***:**** **:*: :: * ::*:*



SGD_Scer_MCD1/YDL003W   201   DIEEGPITSKSWEEGTRQSSRNFDTHENYIQD--DDFPLDDAGTIGWDLG   248
MIT_Smik_c716_3220   201   DIEEGPIISKSWEEGTRQSSHNFGSHENFIQD--DDFPLDDAGAVDWDLC   248
MIT_Spar_c96_3731   200   DIEEGPITSKSWEEGTRQSSRSFGAHENYIQD--DDFPLDDAGTVDWDLG   247
MIT_Suva_c99_600   172   DIEEGPMTSKSWEEGTRQSSHNFGAHENFIQD--DDFPLDDAANVDWDLG   219
WashU_Sbay_Contig611.6   201   DIEEGPMTSKSWEEGTRQSSHNFGAHENFIQD--DDFPLDDAANVDWDLG   248
WashU_Sklu_Contig1584.2   44   DLGDG--QSKSWGEGTNISLNTAAGRSSTVRDHMDEDFPDDDGHIDWDLG   91
WashU_Skud_Contig1672.5   200   DIEEGPVTSKSWEEGTRQSSHNFGTHENFMQD--DDFPLDDAATVDWDLG   247
WashU_Smik_Contig2486.2   201   DIEEGPIISKSWEEGTRQSSHNFGSHENFIQD--DDFPLDDAGAVDWDLG   248
Symbols






*: :* **** ***. * .. :.. ::* *: ** . :.***



SGD_Scer_MCD1/YDL003W   249   ITEKND----------QNNDDDDNSVEQGRRLGESIMSEEPTDFGFDLDI   288
MIT_Smik_c716_3220   249   ITEKNG----------ESSDGDDNSIEQGRKVAESIISEEPTDFGFNLDI   288
MIT_Spar_c96_3731   248   ITEKNG----------HNNDDDDNSVEQGRRLGESIMSEEPTDFGFDLDI   287
MIT_Suva_c99_600   220   ITENNG----------QSDNSDDHSVEQGRRVDGSMMSEEPTDFNFNLDI   259
WashU_Sbay_Contig611.6   249   ITENNG----------QSDNSDDHSVEQGRRVDGSMMSEEPTDFNFNLDI   288
WashU_Sklu_Contig1584.2   92   VSEGNDQLPPQDEHTHDSDDGSDNSVELGRRAVHDDVLP-ETTFDFDLEL   140
WashU_Skud_Contig1672.5   248   ITEKDN----------KSDNGDDNSVEQGRRVDESMISEEPTDFGFNLDI   287
WashU_Smik_Contig2486.2   249   ITEKNG----------ESSDGDDNSIEQGRKVAESIISEEPTDFGFNLDI   288
Symbols






::* :. ...:..*:*:* **: . : * *.*:*::



SGD_Scer_MCD1/YDL003W   289   EKEAPAGNIDTITDAMTESQP-KQTGTRRNSKLLNTKSIQIDEETENSES   337
MIT_Smik_c716_3220   289   EKEIPMNDEDVTADVSTVSLL-KQTGIRRNSQILNTKNIQIDEETENSES   337
MIT_Spar_c96_3731   288   EKETPMGDIDMAADVMTESQP-KQKSTRRNPKLLNTRNIQIDEETEKSES   336
MIT_Suva_c99_600   260   EKDAPMDDMDISTDSIVGLQQSKQTRRRRNSQLTNTKNIQLDEETEYSES   309
WashU_Sbay_Contig611.6   289   EKDAPMDDMDISTDSIVGLQQSKQTRRRRNSQLTNTKNIQLDEETEYSES   338
WashU_Sklu_Contig1584.2   141   DKNSHEQSHQQENLQEETQQMRTPVRRRRNSAITNTKPIVLDNESELKDQ   190
WashU_Skud_Contig1672.5   288   EKEALMDNVDMTANVTTGSQP-EQTRTRRKSQLINARHIKFDEETERPES   336
WashU_Smik_Contig2486.2   289   EKEIPMNDEDVTADVSTVSLL-KQTGIRRNSQILNTKNIQIDEETENSES   337
Symbols






:*: . : **:. : *:: * :*:*:* :.



SGD_Scer_MCD1/YDL003W   338   IAS--SNTYKEERSNNLLTPQPTNFTTKRLWSEITESMSYLPDPILKNFL   385
MIT_Smik_c716_3220   338   LTS--SYTYKEERPKNPIATQRLNFTTKRLWSEITESMSYLPDSIFKNFL   385
MIT_Spar_c96_3731   337   SVS--SNTYKEEGPNNLLISQSANSTTKRLWSEMAGSMSYLPDLILKNFL   384
MIT_Suva_c99_600   310   STS--SNNYKQGGLDNSPTAQRVNLTTKRLWSDLAESMAYLPDSIFKNFL   357
WashU_Sbay_Contig611.6   339   STS--SNNYKQGGLDNSPTAQRVNLTTKRLWSDLAESMAYLPDSIFKNFL   386
WashU_Sklu_Contig1584.2   191   DIKGTSQNLDAVAELGSKSDRIPISNNKRLWVQIGESMDFLPESISTNFL   240
WashU_Skud_Contig1672.5   337   LTS--SNNYEREGLSNSPITQRVSFATKRLWSEITESMSYLPDSIIKDFL   384
WashU_Smik_Contig2486.2   338   LTS--SYTYKEERLKNPIATQRLNFTTKRLWSEITESMSYLPDSIFKNFL   385
Symbols






. * . . . : .**** :: ** :**: * .:**



SGD_Scer_MCD1/YDL003W   386   SYESLKKRKIHNGREGSIE--EPELNVSLNLTDDVISNAGTNDNSFNELT   433
MIT_Smik_c716_3220   386   SYDSSKKRKIQNNPEEPVD--EPELNVSFNLSDDLISNAGTNDGSFNEMT   433
MIT_Spar_c96_3731   385   SYDSLKKRKIKNRPEGPIE--EPELNVSLNLSDDVISNAGTNNESFNELT   432
MIT_Suva_c99_600   358   SYDSLKKRRVQNMIDGSIE--EPELNMSLDLNEDVISNPATSDGSFNDLD   405
WashU_Sbay_Contig611.6   387   SYDSLKKRRVQNMIDGSIE--EPELNMSLDLNEDVISNPATSDGSFNDLD   434
WashU_Sklu_Contig1584.2   241   PYEKIKRQRITPLQERAADDEELQLDISLNLGESSIHNSDIFAQGEDLIN   290
WashU_Skud_Contig1672.5   385   SYDSLKRRRLQNTPEESID--EPELNISLDLNNDLINDLGTNNDSSNELT   432
WashU_Smik_Contig2486.2   386   SYDSSKKRKIQNNPEEPVD--EPELNVSFNLSDDLISNAGTNDGSFNEMT   433
Symbols






.*:. *:::: : . : * :*::*::* :. * : . : :



SGD_Scer_MCD1/YDL003W   434   DNMSDFVPIDAGLNEAPFP------------EENIIDAKTRNEQTTIQTE   471
MIT_Smik_c716_3220   434   DILSDFEPIDAVLNETSFP------------GEDVTRTKTASEDTTIQAQ   471
MIT_Spar_c96_3731   433   DNMSDFVPIDADLNEAPFP------------EDGVAGTKTG-SETTTQTE   469
MIT_Suva_c99_600   406   EDAAEFEPIDADLNEAPLL------------EEELANTSAGSEETTTQTE   443
WashU_Sbay_Contig611.6   435   EDAAEFEPIDADLNEAPLL------------EEELANTSAGSEETTTQTE   472
WashU_Sklu_Contig1584.2   291   IEHGDSYEFNEFPQDNFAEGTAAMSTDMHEYSHIEEDAYSSPIKQLPQSQ   340
WashU_Skud_Contig1672.5   433   NDFSDFVPIDADLNEAPFP------------ENDVTRAKTGREETTIQTE   470
WashU_Smik_Contig2486.2   434   DILSDFEPIDAVLNETSFP------------GEDVTRTKTASEDTTIQAQ   471
Symbols






.: :: :: . : : . *::



SGD_Scer_MCD1/YDL003W   472   KVRPTPGEVASKAIVQMAKILRKELSEEKEVIFTDVLKSQANTEPENITK   521
MIT_Smik_c716_3220   472   KIRLASGEVASKAIVQMAEILRKEITEEKEVIFTDVLKSQANTDLQSITK   521
MIT_Spar_c96_3731   470   KVRLASGEVASKAIVQMAKILRKKLTEENEVIFTDVLKSQADTELENITK   519
MIT_Suva_c99_600   444   KVRLVSGEVASKATVQMAEILRKEITEEKEVIFTNVLRNQLNTSSENITR   493
WashU_Sbay_Contig611.6   473   KVRLVSGEVASKATVQMAEILRKEITEEKEVIFTNVLRNQLNTSSENITR   522
WashU_Sklu_Contig1584.2   341   KIQLSSGETASKSTVVMAEQLRTHFID-NESISFDRIMSAQHSEQESITK   389
WashU_Skud_Contig1672.5   471   KIRLASGEVASKAIVQMAEILRKETAGEKEVIFTDVLRSQVDVDLEKITK   520
WashU_Smik_Contig2486.2   472   KIRLASGEVASKAIVQMAEILRKEITEEKEVIFTDVLKSQANTDLQSITK   521
Symbols






*:: .**.***: * **: **.. :* * : : . . . :.**:



SGD_Scer_MCD1/YDL003W   522   REASRGFFDILSLATEGCIGLSQTEAFGNIKIDAKPALFERFINA   566
MIT_Smik_c716_3220   522   REASKGFFDILSLATEGCIDLSQTETFGSIKIDAKPALFEKFITG   566
MIT_Spar_c96_3731   520   REASKGFFDILSLATEGCIDLGQTETFGNIKIDAKPALFERFIHA   564
MIT_Suva_c99_600   494   REASKGFFDILSLATEGCIDLNQEETFGSIMIDAKPPLFERFITA   538
WashU_Sbay_Contig611.6   523   REASKGFFDILSLATEGCIDLNQEETFGSIMIDAKPPLFERFITA   567
WashU_Sklu_Contig1584.2   390   SQASKAFFEMLTLATADCVDLDQETTFGEISVAAKAPLYEKFIAA   434
WashU_Skud_Contig1672.5   521   KEASKGFFDILSLATEGCIDLSQTKTFGDIKIGAKPALFERFITA   565
WashU_Smik_Contig2486.2   522   REASKGFFDILSLATEGCIDLSQTETFGSIKIDAKPALFEKFITG   566
Symbols






:**:.**::*:*** .*:.*.* :**.* : **..*:*:** .



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_MCD1/YDL003W:

SGD_Scer_MCD1/YDL003W  Length: 567  Mon Nov  7 14:54:48 2016  Type: P  Check: 8525  ..

       1  MVTENPQRLT VLRLATNKGP LAQIWLASNM SNIPRGSVIQ THIAESAKEI

      51  AKASGCDDES GDNEYITLRT SGELLQGIVR VYSKQATFLL TDIKDTLTKI

     101  SMLFKTSQKM TSTVNRLNTV TRVHQLMLED AVTEREVLVT PGLEFLDDTT

     151  IPVGLMAQEN SMERKVQGAA PWDTSLEVGR RFSPDEDFEH NNLSSMNLDF

     201  DIEEGPITSK SWEEGTRQSS RNFDTHENYI QDDDFPLDDA GTIGWDLGIT

     251  EKNDQNNDDD DNSVEQGRRL GESIMSEEPT DFGFDLDIEK EAPAGNIDTI

     301  TDAMTESQPK QTGTRRNSKL LNTKSIQIDE ETENSESIAS SNTYKEERSN

     351  NLLTPQPTNF TTKRLWSEIT ESMSYLPDPI LKNFLSYESL KKRKIHNGRE

     401  GSIEEPELNV SLNLTDDVIS NAGTNDNSFN ELTDNMSDFV PIDAGLNEAP

     451  FPEENIIDAK TRNEQTTIQT EKVRPTPGEV ASKAIVQMAK ILRKELSEEK

     501  EVIFTDVLKS QANTEPENIT KREASRGFFD ILSLATEGCI GLSQTEAFGN

     551  IKIDAKPALF ERFINA*

Protein Sequence for MIT_Smik_c716_3220:

MIT_Smik_c716_3220  Length: 567  Mon Nov  7 14:54:48 2016  Type: P  Check: 9228  ..

       1  MATENSQRLT VLKLATNKGP LAQIWLASNM SNIPRGSIIQ THIAESAKEI

      51  AKASGCDDES REIEHITLRT SAELLQGIVR VYSKQATFLL TDIKDTLTKI

     101  SMLFKTNQRM NATVSRLNTI TRVHQLMLED AVTEREVLVT PGLEFLDDTT

     151  IPVGLMAQEN SMERKVQGAT PWDTSLEVGR RFSPDEDFGH NSISGMDLDF

     201  DIEEGPIISK SWEEGTRQSS HNFGSHENFI QDDDFPLDDA GAVDWDLCIT

     251  EKNGESSDGD DNSIEQGRKV AESIISEEPT DFGFNLDIEK EIPMNDEDVT

     301  ADVSTVSLLK QTGIRRNSQI LNTKNIQIDE ETENSESLTS SYTYKEERPK

     351  NPIATQRLNF TTKRLWSEIT ESMSYLPDSI FKNFLSYDSS KKRKIQNNPE

     401  EPVDEPELNV SFNLSDDLIS NAGTNDGSFN EMTDILSDFE PIDAVLNETS

     451  FPGEDVTRTK TASEDTTIQA QKIRLASGEV ASKAIVQMAE ILRKEITEEK

     501  EVIFTDVLKS QANTDLQSIT KREASKGFFD ILSLATEGCI DLSQTETFGS

     551  IKIDAKPALF EKFITG*

Protein Sequence for MIT_Spar_c96_3731:

MIT_Spar_c96_3731  Length: 565  Mon Nov  7 14:54:48 2016  Type: P  Check: 9704  ..

       1  MVTENPQRLT VLRLATNKGP LAQIWLASNM SNIPRGSVIQ THIAESAKEI

      51  AKASGCDDES GDNEYITLRT SGELLQGIVR VYSKQATFLL TDIKDTLTKI

     101  SMLFRTNQKM NTTVSRLNTV TRVHQLMLED AVTEREVLVT PGLEFLDDTT

     151  IPAGLMAQEN SMERKVQGAA PWDTSLEVGR RFSPDEDFEH NLSGMDLDFD

     201  IEEGPITSKS WEEGTRQSSR SFGAHENYIQ DDDFPLDDAG TVDWDLGITE

     251  KNGHNNDDDD NSVEQGRRLG ESIMSEEPTD FGFDLDIEKE TPMGDIDMAA

     301  DVMTESQPKQ KSTRRNPKLL NTRNIQIDEE TEKSESSVSS NTYKEEGPNN

     351  LLISQSANST TKRLWSEMAG SMSYLPDLIL KNFLSYDSLK KRKIKNRPEG

     401  PIEEPELNVS LNLSDDVISN AGTNNESFNE LTDNMSDFVP IDADLNEAPF

     451  PEDGVAGTKT GSETTTQTEK VRLASGEVAS KAIVQMAKIL RKKLTEENEV

     501  IFTDVLKSQA DTELENITKR EASKGFFDIL SLATEGCIDL GQTETFGNIK

     551  IDAKPALFER FIHA*

Protein Sequence for MIT_Suva_c99_600:

MIT_Suva_c99_600  Length: 539  Mon Nov  7 14:54:48 2016  Type: P  Check: 8327  ..

       1  MSNISRGSAI QTHIAESAKE IAKASGYGDE NESVKHITLR TSGELLQGIV

      51  RVYSKQATFL LTDIKDTLTK ISTLFKTNQG VHVTVSRLNT VTRVDQLILE

     101  DAVTEREVLV TPGLEFLDDT TIPVGLMAQE NSMERKVQGA APWDTSLEVG

     151  RRFNPDEDLE HNHMSSMDLD FDIEEGPMTS KSWEEGTRQS SHNFGAHENF

     201  IQDDDFPLDD AANVDWDLGI TENNGQSDNS DDHSVEQGRR VDGSMMSEEP

     251  TDFNFNLDIE KDAPMDDMDI STDSIVGLQQ SKQTRRRRNS QLTNTKNIQL

     301  DEETEYSESS TSSNNYKQGG LDNSPTAQRV NLTTKRLWSD LAESMAYLPD

     351  SIFKNFLSYD SLKKRRVQNM IDGSIEEPEL NMSLDLNEDV ISNPATSDGS

     401  FNDLDEDAAE FEPIDADLNE APLLEEELAN TSAGSEETTT QTEKVRLVSG

     451  EVASKATVQM AEILRKEITE EKEVIFTNVL RNQLNTSSEN ITRREASKGF

     501  FDILSLATEG CIDLNQEETF GSIMIDAKPP LFERFITA*

Protein Sequence for WashU_Sbay_Contig611.6:

WashU_Sbay_Contig611.6  Length: 568  Mon Nov  7 14:54:48 2016  Type: P  Check: 5880  ..

       1  MATENPQRLT VLKLATNKGP LAQIWLASNM SNISRGSAIQ THIAESAKEI

      51  AKASGYGDEN ESVEHITLRT SGELLQGIVR VYSKQATFLL TDIKDTLTKI

     101  STLFKTNQGV HVTVSRLNTV TRVDQLILED AVTEREVLVT PGLEFLDDTT

     151  IPVGLMAQEN SMERKVQGAA PWDTSLEVGR RFNPDEDLEH NHMSSMDLDF

     201  DIEEGPMTSK SWEEGTRQSS HNFGAHENFI QDDDFPLDDA ANVDWDLGIT

     251  ENNGQSDNSD DHSVEQGRRV DGSMMSEEPT DFNFNLDIEK DAPMDDMDIS

     301  TDSIVGLQQS KQTRRRRNSQ LTNTKNIQLD EETEYSESST SSNNYKQGGL

     351  DNSPTAQRVN LTTKRLWSDL AESMAYLPDS IFKNFLSYDS LKKRRVQNMI

     401  DGSIEEPELN MSLDLNEDVI SNPATSDGSF NDLDEDAAEF EPIDADLNEA

     451  PLLEEELANT SAGSEETTTQ TEKVRLVSGE VASKATVQMA EILRKEITEE

     501  KEVIFTNVLR NQLNTSSENI TRREASKGFF DILSLATEGC IDLNQEETFG

     551  SIMIDAKPPL FERFITA*

Protein Sequence for WashU_Sklu_Contig1584.2:

WashU_Sklu_Contig1584.2  Length: 435  Mon Nov  7 14:54:48 2016  Type: P  Check: 3829  ..

       1  MGGEQSMERH VQGAAAMDRS LELGRRFAPD DDLEQHSTLD LNFDLGDGQS

      51  KSWGEGTNIS LNTAAGRSST VRDHMDEDFP DDDGHIDWDL GVSEGNDQLP

     101  PQDEHTHDSD DGSDNSVELG RRAVHDDVLP ETTFDFDLEL DKNSHEQSHQ

     151  QENLQEETQQ MRTPVRRRRN SAITNTKPIV LDNESELKDQ DIKGTSQNLD

     201  AVAELGSKSD RIPISNNKRL WVQIGESMDF LPESISTNFL PYEKIKRQRI

     251  TPLQERAADD EELQLDISLN LGESSIHNSD IFAQGEDLIN IEHGDSYEFN

     301  EFPQDNFAEG TAAMSTDMHE YSHIEEDAYS SPIKQLPQSQ KIQLSSGETA

     351  SKSTVVMAEQ LRTHFIDNES ISFDRIMSAQ HSEQESITKS QASKAFFEML

     401  TLATADCVDL DQETTFGEIS VAAKAPLYEK FIAA*

Protein Sequence for WashU_Skud_Contig1672.5:

WashU_Skud_Contig1672.5  Length: 566  Mon Nov  7 14:54:48 2016  Type: P  Check: 8029  ..

       1  MTTENPQRLT VLKLATNKGP LAQIWLASNM SNISRGSVIQ THIAESAKEI

      51  AKASGCGDET ESTEHITLRT SGELLQGIVR VYSKQATFLL TDIKDTLTKI

     101  STLFKTNQKI NTTVSRLNTV TRVHQLMLED AVTEREVLVT PGLEFLDDTT

     151  IPVGLMAQEN SMERKVQGAA PWDTSLEVGR RFNPDEDFEH NVSGMDLDFD

     201  IEEGPVTSKS WEEGTRQSSH NFGTHENFMQ DDDFPLDDAA TVDWDLGITE

     251  KDNKSDNGDD NSVEQGRRVD ESMISEEPTD FGFNLDIEKE ALMDNVDMTA

     301  NVTTGSQPEQ TRTRRKSQLI NARHIKFDEE TERPESLTSS NNYEREGLSN

     351  SPITQRVSFA TKRLWSEITE SMSYLPDSII KDFLSYDSLK RRRLQNTPEE

     401  SIDEPELNIS LDLNNDLIND LGTNNDSSNE LTNDFSDFVP IDADLNEAPF

     451  PENDVTRAKT GREETTIQTE KIRLASGEVA SKAIVQMAEI LRKETAGEKE

     501  VIFTDVLRSQ VDVDLEKITK KEASKGFFDI LSLATEGCID LSQTKTFGDI

     551  KIGAKPALFE RFITA*

Protein Sequence for WashU_Smik_Contig2486.2:

WashU_Smik_Contig2486.2  Length: 567  Mon Nov  7 14:54:48 2016  Type: P  Check: 8461  ..

       1  MATENSQRLT VLKLATNKGP LAQIWLASNM SNIPRGSIIQ THIAESAKEI

      51  AKASGCDDES REIEHITLRT SAELLQGIVR VYSKQATFLL TDIKDTLTKI

     101  SMLFKTNQRM NATVSRLNTI TRVHQLMLED AVTEREVLVT PGLEFLDDTT

     151  IPAGLMAQEN SMERKVQGAT PWDTSLEVGR RFSPDEDFGH NSISGMDLDF

     201  DIEEGPIISK SWEEGTRQSS HNFGSHENFI QDDDFPLDDA GAVDWDLGIT

     251  EKNGESSDGD DNSIEQGRKV AESIISEEPT DFGFNLDIEK EIPMNDEDVT

     301  ADVSTVSLLK QTGIRRNSQI LNTKNIQIDE ETENSESLTS SYTYKEERLK

     351  NPIATQRLNF TTKRLWSEIT ESMSYLPDSI FKNFLSYDSS KKRKIQNNPE

     401  EPVDEPELNV SFNLSDDLIS NAGTNDGSFN EMTDILSDFE PIDAVLNETS

     451  FPGEDVTRTK TASEDTTIQA QKIRLASGEV ASKAIVQMAE ILRKEITEEK

     501  EVIFTDVLKS QANTDLQSIT KREASKGFFD ILSLATEGCI DLSQTETFGS

     551  IKIDAKPALF EKFITG*