Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YCL059C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_KRR1/YCL059C   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
MIT_Smik_c212_2245   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
MIT_Spar_c84_2217   1   MVSTHNRDKPWDTNDIDKWKIEEFKEEDNVSGQPFAEESSFMTLFPKYRE   50
MIT_Suva_c1075_2380   1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
WashU_Sbay_Contig623.16   1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
WashU_Scas_Contig642.16   1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKIQR   50
WashU_Sklu_Contig1916.1   1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYRE   50
WashU_Skud_Contig2065.14   1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYRE   50
WashU_Smik_Contig1194.1   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
Symbols






* ****::***** ::*** ***** *** ** ************** :.



SGD_Scer_KRR1/YCL059C   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
MIT_Smik_c212_2245   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
MIT_Spar_c84_2217   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
MIT_Suva_c1075_2380   51   NYLKTIWNDVTRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
WashU_Sbay_Contig623.16   51   NYLKTIWNDVTRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
WashU_Scas_Contig642.16   51   NIFEICMEX-----------------------------------------   59
WashU_Sklu_Contig1916.1   51   AYLKSVWNDVTRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDL   100
WashU_Skud_Contig2065.14   51   GYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
WashU_Smik_Contig1194.1   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
Symbols






:: :



SGD_Scer_KRR1/YCL059C   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
MIT_Smik_c212_2245   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
MIT_Spar_c84_2217   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
MIT_Suva_c1075_2380   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
WashU_Sbay_Contig623.16   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
WashU_Scas_Contig642.16   
   --------------------------------------------------   
WashU_Sklu_Contig1916.1   101   IKLLARSVPFPQAVKILEDDVACDVIKIGNFVSNKERFVKRRQRLVGPNG   150
WashU_Skud_Contig2065.14   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
WashU_Smik_Contig1194.1   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
Symbols










SGD_Scer_KRR1/YCL059C   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
MIT_Smik_c212_2245   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNVHPIYHI   200
MIT_Spar_c84_2217   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
MIT_Suva_c1075_2380   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNVHPIYHI   200
WashU_Sbay_Contig623.16   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNVHPIYHI   200
WashU_Scas_Contig642.16   
   --------------------------------------------------   
WashU_Sklu_Contig1916.1   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNVHPIYHI   200
WashU_Skud_Contig2065.14   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
WashU_Smik_Contig1194.1   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNVHPIYHI   200
Symbols










SGD_Scer_KRR1/YCL059C   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
MIT_Smik_c212_2245   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNIEKKVYTP   250
MIT_Spar_c84_2217   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
MIT_Suva_c1075_2380   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNIEKKVYTP   250
WashU_Sbay_Contig623.16   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNIEKKVYTP   250
WashU_Scas_Contig642.16   
   --------------------------------------------------   
WashU_Sklu_Contig1916.1   201   KELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKAKAKEKKVYTP   250
WashU_Skud_Contig2065.14   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
WashU_Smik_Contig1194.1   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNIEKKVYTP   250
Symbols










SGD_Scer_KRR1/YCL059C   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
MIT_Smik_c212_2245   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLSEQKEKQMEREIERQEERA   300
MIT_Spar_c84_2217   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREVERQEERA   300
MIT_Suva_c1075_2380   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREVERQEERA   300
WashU_Sbay_Contig623.16   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREVERQEERA   300
WashU_Scas_Contig642.16   
   --------------------------------------------------   
WashU_Sklu_Contig1916.1   251   FPPAQLPRKVDLEIESGEYFLSKKEKEVKKLQERRQEQAEKQAQKEEERA   300
WashU_Skud_Contig2065.14   251   FPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNEQKEKQMERELERQEERA   300
WashU_Smik_Contig1194.1   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLSEQKEKQMEREIERQEERA   300
Symbols










SGD_Scer_KRR1/YCL059C   301   KDFIAPEEEAYKPNQN-----------------------   316
MIT_Smik_c212_2245   301   KDFIAPEEETYKPNQN-----------------------   316
MIT_Spar_c84_2217   301   KDFIAPEEEAYKPNQN-----------------------   316
MIT_Suva_c1075_2380   301   KNFVAPQEEAYKPNNN-----------------------   316
WashU_Sbay_Contig623.16   301   KNFVAPQEEAYKPNNN-----------------------   316
WashU_Scas_Contig642.16   
   ---------------------------------------   
WashU_Sklu_Contig1916.1   301   KDYVAPEEAEYKSTLKKRSKDNDGDAEEKPKKKKKKSKD   339
WashU_Skud_Contig2065.14   301   KDFTAPEEESYKPSKN-----------------------   316
WashU_Smik_Contig1194.1   301   KDFIAPEEETYKPNQN-----------------------   316
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_KRR1/YCL059C:

SGD_Scer_KRR1/YCL059C  Length: 317  Mon Nov  7 14:51:51 2016  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for MIT_Smik_c212_2245:

MIT_Smik_c212_2245  Length: 317  Mon Nov  7 14:51:51 2016  Type: P  Check: 1063  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNVHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNIEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LSEQKEKQME REIERQEERA

     301  KDFIAPEEET YKPNQN*

Protein Sequence for MIT_Spar_c84_2217:

MIT_Spar_c84_2217  Length: 317  Mon Nov  7 14:51:51 2016  Type: P  Check: 1088  ..

       1  MVSTHNRDKP WDTNDIDKWK IEEFKEEDNV SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REVERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for MIT_Suva_c1075_2380:

MIT_Suva_c1075_2380  Length: 317  Mon Nov  7 14:51:51 2016  Type: P  Check: 1380  ..

       1  MVSTHNRDKP WDTDDVDKWT IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  NYLKTIWNDV TRALDKHNIS CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNVHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNIEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REVERQEERA

     301  KNFVAPQEEA YKPNNN*

Protein Sequence for WashU_Sbay_Contig623.16:

WashU_Sbay_Contig623.16  Length: 317  Mon Nov  7 14:51:51 2016  Type: P  Check: 1380  ..

       1  MVSTHNRDKP WDTDDVDKWT IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  NYLKTIWNDV TRALDKHNIS CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNVHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNIEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REVERQEERA

     301  KNFVAPQEEA YKPNNN*

Protein Sequence for WashU_Scas_Contig642.16:

WashU_Scas_Contig642.16  Length: 59  Mon Nov  7 14:51:51 2016  Type: P  Check: 3681  ..

       1  MVSTHNRDKP WDTPDVDKWH IEEFKPEDNA SGLPFAEESS FMTLFPKIQR

      51  NIFEICMEX

Protein Sequence for WashU_Sklu_Contig1916.1:

WashU_Sklu_Contig1916.1  Length: 340  Mon Nov  7 14:51:51 2016  Type: P  Check: 4184  ..

       1  MPSTHNKDKP WDTPEIDKWK IEEFKPEDNA SGLPFAEESS FMTLFPKYRE

      51  AYLKSVWNDV TRALDKHHIA CTLDLVEGSM SVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILEDD VACDVIKIGN FVSNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNVHPIYHI

     201  KELMIKRELA KRPELAEEDW SRFLPMFKKR NVARKKPKKA KAKEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKKEKEVKK LQERRQEQAE KQAQKEEERA

     301  KDYVAPEEAE YKSTLKKRSK DNDGDAEEKP KKKKKKSKD*

Protein Sequence for WashU_Skud_Contig2065.14:

WashU_Skud_Contig2065.14  Length: 317  Mon Nov  7 14:51:51 2016  Type: P  Check: 841  ..

       1  MVSTHNREKP WDTDDIDKWK IEEFKEEDNG SGQPFAEESS FMTLFPKYRE

      51  GYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKRDKQVKK LNEQKEKQME RELERQEERA

     301  KDFTAPEEES YKPSKN*

Protein Sequence for WashU_Smik_Contig1194.1:

WashU_Smik_Contig1194.1  Length: 317  Mon Nov  7 14:51:51 2016  Type: P  Check: 1063  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNVHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNIEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LSEQKEKQME REIERQEERA

     301  KDFIAPEEET YKPNQN*