Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YCL040W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_GLK1/YCL040W   1   MSFDDLHKATERAVIQAVDQICDDFEVTPEKLDELTAYFIEQMEKGLAPP   50
MIT_Smik_c212_2176   1   MSFDDLHKATERAVIQAVDQICDEFEVTPEKLDELTAYFIEQMEKGLTPP   50
MIT_Spar_c84_2283   1   MSFDDLHKATERAVIQAVDQICDDFEVTPEKLDELTAYFIEQMEKGLAPP   50
MIT_Suva_c95_2450   1   MSFDDLHKATERAVIQAVDQICDEFEVTPEKLDELTAYFIEQMEKGLTPP   50
WashU_Sbay_Contig675.2   1   MSFDDLHKATERAVIQAVDQICDEFEVTPEKLDELTAYFIEQMEKGLTPP   50
WashU_Scas_Contig642.3   1   MSFEDLHKATAQALTKAVDELVAEFEVTPAKLDELTAYFIEQMEKGLKP-   49
WashU_Sklu_Contig2113.1   1   MSFEDLHKQKQGKLTAKVNAICDEFSIDSKKLHELTNYFIESMEKGLSPH   50
WashU_Skud_Contig2072.5   1   MSFDDLHKATERAVIQAVDQICDEFEVTPEKLDELTAYFIEQMEKGLTPP   50
Symbols






***:**** . : *: : :*.: . **.*** ****.***** *



SGD_Scer_GLK1/YCL040W   51   KEGHTLASDKGLPMIPAFVTGSPNGTERGVLLAADLGGTNFRICSVNLHG   100
MIT_Smik_c212_2176   51   KEGHTLASDKGLPMIPAFVTGSPNGTERGVLLAADLGGTNFRICSVNLHG   100
MIT_Spar_c84_2283   51   KEGHTLASDKGLPMIPAFVTGSPNGTERGVLLAADLGGTNFRICSVNLHG   100
MIT_Suva_c95_2450   51   KQAHALASDKGLPMIPAFVTGSPNGTERGVLLAADLGGTNFRICSVDLHG   100
WashU_Sbay_Contig675.2   51   KQAHALASDKGLPMIPAFVTGSPNGTERGVLLAADLGGTNFRICSVDLHG   100
WashU_Scas_Contig642.3   50   --TADKATDLGLPMIPSYVTGIPNGTEKGVLLAADLGGTNFRVCSVELNG   97
WashU_Sklu_Contig2113.1   51   HEQQGQVY-KGLPMIPTYVMGKPNGTEQGILLAADLGGTNFRVCSVDLHG   99
WashU_Skud_Contig2072.5   51   QEGHTLASDKGLPMIPAFVTGSPNGTERGVLLAADLGGTNFRICSVNLHG   100
Symbols






. ******::* * *****:*:************:***:*:*



SGD_Scer_GLK1/YCL040W   101   DHTFSMEQMKSKIPDDLLDDENVTSDDLFGFLARRTLAFMKKYHPDELAK   150
MIT_Smik_c212_2176   101   DHTFSMEQMKSKIPDDLLDDESVTSDDLFGFLARRTLAFMKKYHPDELAK   150
MIT_Spar_c84_2283   101   DHTFSMEQMKSKIPDDLLDDENVTSDDLFGFLARRTLAFMKKYHPDELAK   150
MIT_Suva_c95_2450   101   DHTFAMEQMKSKIPDDLLDDESVTSDDLFGFLARRTLAFMKKYHPDELAR   150
WashU_Sbay_Contig675.2   101   DHTFAMEQMKSKIPDDLLDDESVTSDDLFGFLARRTLAFMKKYHPDELAR   150
WashU_Scas_Contig642.3   98   DHTYNMEQMKAKIPDELLDDDTATSEQLFGFLARRTLAFMKKFHPEILEQ   147
WashU_Sklu_Contig2113.1   100   DHTFELQQLKSKIPEELLEDESVTSNELFGYLARRTAVFVKKFHPEYLE-   148
WashU_Skud_Contig2072.5   101   DHSFSMEQMKSKIPDDLLDDENVTSDDLFGFLARRTLAFMKKYHPDELAQ   150
Symbols






**:: ::*:*:***::**:*:..**::***:***** .*:**:**: *



SGD_Scer_GLK1/YCL040W   151   GKDAKPMKLGFTFSYPVDQTSLNSGTLIRWTKGFRIADTVGKDVVQLYQE   200
MIT_Smik_c212_2176   151   GKDAKPMKLGFTFSYPVDQTSLNSGTLIRWTKGFRIADTVGKDVVQLYQE   200
MIT_Spar_c84_2283   151   GKDANPMRLGFTFSYPVDQTSLNSGTLIRWTKGFRIADTVGKDVVQLYQE   200
MIT_Suva_c95_2450   151   GKDAKPMKLGFTFSYPVDQTSLNSGTLIRWTKGFRIADTVGKDVVQLYQE   200
WashU_Sbay_Contig675.2   151   GKDAKPMKLGFTFSYPVDQTSLNSGTLIRWTKGFRIADTVGKDVVQLYQE   200
WashU_Scas_Contig642.3   148   GDAAKPVKLGFTFSYPVDQTSLNSGTLIRWTKGFKIPDTVGKDVVELYQT   197
WashU_Sklu_Contig2113.1   149   GDSQQELRLGFTFSYPVDQTSLSSGTLIRWTKGFKIRDTIGQDVVQLYQH   198
WashU_Skud_Contig2072.5   151   GKDAKPMKLGFTFSYPVDQTSLNSGTLIRWTKGFRIADTVGKDVVQLYQE   200
Symbols






*. : ::**************.***********:* **:*:***:***



SGD_Scer_GLK1/YCL040W   201   QLSAQGMPMIKVVALTNDTVGTYLSHCYTSDNTDSMTSGEISEPVIGCIF   250
MIT_Smik_c212_2176   201   QLCAQGMPMIKVVALTNDTVGTYLSHCYTSDNTDSMTSGEISEPVIGCIF   250
MIT_Spar_c84_2283   201   QLRAQGMPMVKVVALTNDTVGTYLSHCYTSDNTDSMTSGEISEPVIGCIF   250
MIT_Suva_c95_2450   201   QLRAQGMPMIKVVALTNDTVGTYLSHCYTSDNTDSMTSGEISEPVIGCIF   250
WashU_Sbay_Contig675.2   201   QLRAQGMPMIKVVALTNDTVGTYLSHCYTSDNTDSMTSGEISEPVIGCIF   250
WashU_Scas_Contig642.3   198   ALKKAGLPMVNVVALTNDTVGTLLSHGYTSDNTDSMTTGEISEPIIGCIF   247
WashU_Sklu_Contig2113.1   199   HLDQQGLSMIRVVALANDTVGTFLSHCYGSMNSDSMTTGEISEPVIGCIF   248
WashU_Skud_Contig2072.5   201   QLRAQGMPMVKVVALTNDTVGTYLSHCYTSDNTDSMTSGEISEPVIGCIF   250
Symbols






* *:.*:.****:****** *** * * *:****:******:*****



SGD_Scer_GLK1/YCL040W   251   GTGTNGCYMEEINKITKLPQELRDKLIKEGKTHMIINVEWGSFDNELKHL   300
MIT_Smik_c212_2176   251   GTGTNGCYMEEINNITKLPQELRDKLINEGKTHMIINVEWGSFDNELKHL   300
MIT_Spar_c84_2283   251   GTGTNGCYMEEINKITKLPQELRDKLIKEGKTHMIINVEWGSFDNELKHL   300
MIT_Suva_c95_2450   251   GTGTNGCYMEEIDKITKLPQELREKLAHEGKTHMIINVEWGSFDNELKHL   300
WashU_Sbay_Contig675.2   251   GTGTNGCYMEEIDKITKLPQELREKLAHEGKTHMIINVEWGSFDNELKHL   300
WashU_Scas_Contig642.3   248   GTGTNGCYMEEIEKITKLPEDLKKKLLAQGKTHMIINTEWGSFDNELKHL   297
WashU_Sklu_Contig2113.1   249   GTGTNGCYMEEIPNIKKLSEEVRETLLKQGKTHMCINTEWGSFDNDLKHL   298
WashU_Skud_Contig2072.5   251   GTGTNGCYMEEINKITKLPQELRDKLIKEGKTHMIINVEWGSFDNELKHL   300
Symbols






************ :*.**.::::..* :***** **.*******:****



SGD_Scer_GLK1/YCL040W   301   PTTKYDVVIDQKLSTNPGFHLFEKRVSGMFLGEVLRNILVDLHSQGLLLQ   350
MIT_Smik_c212_2176   301   PTTKYDVVIDQKLSTNPGFHLFEKRVSGMFLGEVLRNILVDLHSQGLLLQ   350
MIT_Spar_c84_2283   301   PTTKYDVVIDQKLSTNPGFHLFEKRVSGMFLGEVLRNILVDLHSQGLLLQ   350
MIT_Suva_c95_2450   301   PTTKYDIVIDQKLSTNPGFHLFEKRVSGMFLGEVLRNILVDLHSQGLLLQ   350
WashU_Sbay_Contig675.2   301   PTTKYDIVIDQKLSTNPGFHLFEKRVSGMFLGEVLRNILVDLHSQGLLLQ   350
WashU_Scas_Contig642.3   298   PATKYDIAIDKASAN-PGFHLFEKRVSGMYLGEVLRCVLVDLYKRGLIFS   346
WashU_Sklu_Contig2113.1   299   PTTKYDIAIDQKYSSNPGFHLFEKRVSGMFLGELLRNVLVDLHAQGLIFS   348
WashU_Skud_Contig2072.5   301   PTTKYDVVIDQKLSTNPGFHLFEKRVSGMFLGEVLRNVLVDLHSQGLLLQ   350
Symbols






*:****:.**: :. *************:***:** :****: :**::.



SGD_Scer_GLK1/YCL040W   351   QYRSKEQLPRHLTTPFQLSSEVLSHIEIDDSTGLRETELSLLQSLRLPTT   400
MIT_Smik_c212_2176   351   QYRSKEQLPRHLTTPFQLSSEVLSHIEIDDSTGLRETELSLLQSLRLPTT   400
MIT_Spar_c84_2283   351   QYRTKEQLPRHLTTPFQLSSEVLSHIEIDDSTGLRETELSLLQSLRLPTT   400
MIT_Suva_c95_2450   351   QYRSKEQLPRHLTTPFQLSSEVLSHIEIDDSTGLRETELSLLQSLRLPTT   400
WashU_Sbay_Contig675.2   351   QYRSKEQLPRHLTTPFQLSSEVLSHIEIDDSTGLRETELSLLQSLRLPTT   400
WashU_Scas_Contig642.3   347   QYRSEKQLPHRLQTEFELDSEVLSHIEIDDSTGLRETELSLLQSLRLPTS   396
WashU_Sklu_Contig2113.1   349   QYSRYEHLPHHLKTPFDLSSEVLSHIEIDDSSKLRETELSLLQSLRLPTT   398
WashU_Skud_Contig2072.5   351   QYRTKEQLPRHLTTPFQLSSEVLSHIEIDDSTGLRETELSLLQSLRLPTT   400
Symbols






** ::**::* * *:*.************: ****************:



SGD_Scer_GLK1/YCL040W   401   PTERVQIQKLVRAISRRSAYLAAVPLAAILIKTNALNKRYHGEVEIGCDG   450
MIT_Smik_c212_2176   401   PTERVQIQKLVRAISRRSAYLAAVPLAAILIKTNALNKRYHGEVEIGCDG   450
MIT_Spar_c84_2283   401   PTERVQIQKLVRAISRRSAYLAAVPLAAILIKTNALNKRYHGEVEIGCDG   450
MIT_Suva_c95_2450   401   PTERVQIQKLVRAISRRSAYLAAVPLAAILIKTNALNKRYHGEVEIGCDG   450
WashU_Sbay_Contig675.2   401   PTERVQIQKLVRAISRRSAYLAAVPLAAILIKTNALNKRYHGEVEIGCDG   450
WashU_Scas_Contig642.3   397   PSERIEIQKLVRAISRRSAYLAAVPIAAIIIKTGVLNKRYHGEVEVGCDG   446
WashU_Sklu_Contig2113.1   399   YAERVEIQKLVRAISRRSAYLSAVPISAILIKTNALNMRYHGEVEIGCDG   448
WashU_Skud_Contig2072.5   401   PTERMQIQKLVRAISRRSAYLAAVPLAAILIKTNALNKRYHGEVEIGCDG   450
Symbols






:**::***************:***::**:***..** *******:****



SGD_Scer_GLK1/YCL040W   451   SVVEYYPGFRSMLRHALALSPLGAEGERKVHLKIAKDGSGVGAALCALVA   500
MIT_Smik_c212_2176   451   SVVEYYPGFRSMLRHALALSPLGAEGERKVHLKIAKDGSGVGAALCALVA   500
MIT_Spar_c84_2283   451   SVVEYYPGFRSMLRHALALSPLGAEGERKVHLKIAKDGSGVGAALCALVA   500
MIT_Suva_c95_2450   451   SVVEYYPGFRSMLRHALALSPLGAEGERKVHLKIAKDGSGVGAALCALVA   500
WashU_Sbay_Contig675.2   451   SVVEYYPGFRSMLRHALALSPLGAEGERKVHLKIAKDGSGVGAALCALVA   500
WashU_Scas_Contig642.3   447   SVIEYYPGFRSMLRHALAISPLGAEGERKVHLKLAKDGSGTGAALCALVA   496
WashU_Sklu_Contig2113.1   449   SVVEYYPGFRSMMRHALALSPIGPDGERKVHLCIAKDGSGVGAALCALVA   498
WashU_Skud_Contig2072.5   451   SVVEYYPGFRSMLRHALALSPLGAEGERKVHLKIAKDGSGVGAALCALVA   500
Symbols






**:*********:*****:**:*.:******* :******.*********



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_GLK1/YCL040W:

SGD_Scer_GLK1/YCL040W  Length: 501  Mon Nov  7 14:51:27 2016  Type: P  Check: 2651  ..

       1  MSFDDLHKAT ERAVIQAVDQ ICDDFEVTPE KLDELTAYFI EQMEKGLAPP

      51  KEGHTLASDK GLPMIPAFVT GSPNGTERGV LLAADLGGTN FRICSVNLHG

     101  DHTFSMEQMK SKIPDDLLDD ENVTSDDLFG FLARRTLAFM KKYHPDELAK

     151  GKDAKPMKLG FTFSYPVDQT SLNSGTLIRW TKGFRIADTV GKDVVQLYQE

     201  QLSAQGMPMI KVVALTNDTV GTYLSHCYTS DNTDSMTSGE ISEPVIGCIF

     251  GTGTNGCYME EINKITKLPQ ELRDKLIKEG KTHMIINVEW GSFDNELKHL

     301  PTTKYDVVID QKLSTNPGFH LFEKRVSGMF LGEVLRNILV DLHSQGLLLQ

     351  QYRSKEQLPR HLTTPFQLSS EVLSHIEIDD STGLRETELS LLQSLRLPTT

     401  PTERVQIQKL VRAISRRSAY LAAVPLAAIL IKTNALNKRY HGEVEIGCDG

     451  SVVEYYPGFR SMLRHALALS PLGAEGERKV HLKIAKDGSG VGAALCALVA

     501  *

Protein Sequence for MIT_Smik_c212_2176:

MIT_Smik_c212_2176  Length: 501  Mon Nov  7 14:51:27 2016  Type: P  Check: 3373  ..

       1  MSFDDLHKAT ERAVIQAVDQ ICDEFEVTPE KLDELTAYFI EQMEKGLTPP

      51  KEGHTLASDK GLPMIPAFVT GSPNGTERGV LLAADLGGTN FRICSVNLHG

     101  DHTFSMEQMK SKIPDDLLDD ESVTSDDLFG FLARRTLAFM KKYHPDELAK

     151  GKDAKPMKLG FTFSYPVDQT SLNSGTLIRW TKGFRIADTV GKDVVQLYQE

     201  QLCAQGMPMI KVVALTNDTV GTYLSHCYTS DNTDSMTSGE ISEPVIGCIF

     251  GTGTNGCYME EINNITKLPQ ELRDKLINEG KTHMIINVEW GSFDNELKHL

     301  PTTKYDVVID QKLSTNPGFH LFEKRVSGMF LGEVLRNILV DLHSQGLLLQ

     351  QYRSKEQLPR HLTTPFQLSS EVLSHIEIDD STGLRETELS LLQSLRLPTT

     401  PTERVQIQKL VRAISRRSAY LAAVPLAAIL IKTNALNKRY HGEVEIGCDG

     451  SVVEYYPGFR SMLRHALALS PLGAEGERKV HLKIAKDGSG VGAALCALVA

     501  *

Protein Sequence for MIT_Spar_c84_2283:

MIT_Spar_c84_2283  Length: 501  Mon Nov  7 14:51:27 2016  Type: P  Check: 3569  ..

       1  MSFDDLHKAT ERAVIQAVDQ ICDDFEVTPE KLDELTAYFI EQMEKGLAPP

      51  KEGHTLASDK GLPMIPAFVT GSPNGTERGV LLAADLGGTN FRICSVNLHG

     101  DHTFSMEQMK SKIPDDLLDD ENVTSDDLFG FLARRTLAFM KKYHPDELAK

     151  GKDANPMRLG FTFSYPVDQT SLNSGTLIRW TKGFRIADTV GKDVVQLYQE

     201  QLRAQGMPMV KVVALTNDTV GTYLSHCYTS DNTDSMTSGE ISEPVIGCIF

     251  GTGTNGCYME EINKITKLPQ ELRDKLIKEG KTHMIINVEW GSFDNELKHL

     301  PTTKYDVVID QKLSTNPGFH LFEKRVSGMF LGEVLRNILV DLHSQGLLLQ

     351  QYRTKEQLPR HLTTPFQLSS EVLSHIEIDD STGLRETELS LLQSLRLPTT

     401  PTERVQIQKL VRAISRRSAY LAAVPLAAIL IKTNALNKRY HGEVEIGCDG

     451  SVVEYYPGFR SMLRHALALS PLGAEGERKV HLKIAKDGSG VGAALCALVA

     501  *

Protein Sequence for MIT_Suva_c95_2450:

MIT_Suva_c95_2450  Length: 501  Mon Nov  7 14:51:27 2016  Type: P  Check: 712  ..

       1  MSFDDLHKAT ERAVIQAVDQ ICDEFEVTPE KLDELTAYFI EQMEKGLTPP

      51  KQAHALASDK GLPMIPAFVT GSPNGTERGV LLAADLGGTN FRICSVDLHG

     101  DHTFAMEQMK SKIPDDLLDD ESVTSDDLFG FLARRTLAFM KKYHPDELAR

     151  GKDAKPMKLG FTFSYPVDQT SLNSGTLIRW TKGFRIADTV GKDVVQLYQE

     201  QLRAQGMPMI KVVALTNDTV GTYLSHCYTS DNTDSMTSGE ISEPVIGCIF

     251  GTGTNGCYME EIDKITKLPQ ELREKLAHEG KTHMIINVEW GSFDNELKHL

     301  PTTKYDIVID QKLSTNPGFH LFEKRVSGMF LGEVLRNILV DLHSQGLLLQ

     351  QYRSKEQLPR HLTTPFQLSS EVLSHIEIDD STGLRETELS LLQSLRLPTT

     401  PTERVQIQKL VRAISRRSAY LAAVPLAAIL IKTNALNKRY HGEVEIGCDG

     451  SVVEYYPGFR SMLRHALALS PLGAEGERKV HLKIAKDGSG VGAALCALVA

     501  *

Protein Sequence for WashU_Sbay_Contig675.2:

WashU_Sbay_Contig675.2  Length: 501  Mon Nov  7 14:51:27 2016  Type: P  Check: 712  ..

       1  MSFDDLHKAT ERAVIQAVDQ ICDEFEVTPE KLDELTAYFI EQMEKGLTPP

      51  KQAHALASDK GLPMIPAFVT GSPNGTERGV LLAADLGGTN FRICSVDLHG

     101  DHTFAMEQMK SKIPDDLLDD ESVTSDDLFG FLARRTLAFM KKYHPDELAR

     151  GKDAKPMKLG FTFSYPVDQT SLNSGTLIRW TKGFRIADTV GKDVVQLYQE

     201  QLRAQGMPMI KVVALTNDTV GTYLSHCYTS DNTDSMTSGE ISEPVIGCIF

     251  GTGTNGCYME EIDKITKLPQ ELREKLAHEG KTHMIINVEW GSFDNELKHL

     301  PTTKYDIVID QKLSTNPGFH LFEKRVSGMF LGEVLRNILV DLHSQGLLLQ

     351  QYRSKEQLPR HLTTPFQLSS EVLSHIEIDD STGLRETELS LLQSLRLPTT

     401  PTERVQIQKL VRAISRRSAY LAAVPLAAIL IKTNALNKRY HGEVEIGCDG

     451  SVVEYYPGFR SMLRHALALS PLGAEGERKV HLKIAKDGSG VGAALCALVA

     501  *

Protein Sequence for WashU_Scas_Contig642.3:

WashU_Scas_Contig642.3  Length: 497  Mon Nov  7 14:51:27 2016  Type: P  Check: 8202  ..

       1  MSFEDLHKAT AQALTKAVDE LVAEFEVTPA KLDELTAYFI EQMEKGLKPT

      51  ADKATDLGLP MIPSYVTGIP NGTEKGVLLA ADLGGTNFRV CSVELNGDHT

     101  YNMEQMKAKI PDELLDDDTA TSEQLFGFLA RRTLAFMKKF HPEILEQGDA

     151  AKPVKLGFTF SYPVDQTSLN SGTLIRWTKG FKIPDTVGKD VVELYQTALK

     201  KAGLPMVNVV ALTNDTVGTL LSHGYTSDNT DSMTTGEISE PIIGCIFGTG

     251  TNGCYMEEIE KITKLPEDLK KKLLAQGKTH MIINTEWGSF DNELKHLPAT

     301  KYDIAIDKAS ANPGFHLFEK RVSGMYLGEV LRCVLVDLYK RGLIFSQYRS

     351  EKQLPHRLQT EFELDSEVLS HIEIDDSTGL RETELSLLQS LRLPTSPSER

     401  IEIQKLVRAI SRRSAYLAAV PIAAIIIKTG VLNKRYHGEV EVGCDGSVIE

     451  YYPGFRSMLR HALAISPLGA EGERKVHLKL AKDGSGTGAA LCALVA*


Protein Sequence for WashU_Sklu_Contig2113.1:

WashU_Sklu_Contig2113.1  Length: 499  Mon Nov  7 14:51:27 2016  Type: P  Check: 9905  ..

       1  MSFEDLHKQK QGKLTAKVNA ICDEFSIDSK KLHELTNYFI ESMEKGLSPH

      51  HEQQGQVYKG LPMIPTYVMG KPNGTEQGIL LAADLGGTNF RVCSVDLHGD

     101  HTFELQQLKS KIPEELLEDE SVTSNELFGY LARRTAVFVK KFHPEYLEGD

     151  SQQELRLGFT FSYPVDQTSL SSGTLIRWTK GFKIRDTIGQ DVVQLYQHHL

     201  DQQGLSMIRV VALANDTVGT FLSHCYGSMN SDSMTTGEIS EPVIGCIFGT

     251  GTNGCYMEEI PNIKKLSEEV RETLLKQGKT HMCINTEWGS FDNDLKHLPT

     301  TKYDIAIDQK YSSNPGFHLF EKRVSGMFLG ELLRNVLVDL HAQGLIFSQY

     351  SRYEHLPHHL KTPFDLSSEV LSHIEIDDSS KLRETELSLL QSLRLPTTYA

     401  ERVEIQKLVR AISRRSAYLS AVPISAILIK TNALNMRYHG EVEIGCDGSV

     451  VEYYPGFRSM MRHALALSPI GPDGERKVHL CIAKDGSGVG AALCALVA*


Protein Sequence for WashU_Skud_Contig2072.5:

WashU_Skud_Contig2072.5  Length: 501  Mon Nov  7 14:51:27 2016  Type: P  Check: 5185  ..

       1  MSFDDLHKAT ERAVIQAVDQ ICDEFEVTPE KLDELTAYFI EQMEKGLTPP

      51  QEGHTLASDK GLPMIPAFVT GSPNGTERGV LLAADLGGTN FRICSVNLHG

     101  DHSFSMEQMK SKIPDDLLDD ENVTSDDLFG FLARRTLAFM KKYHPDELAQ

     151  GKDAKPMKLG FTFSYPVDQT SLNSGTLIRW TKGFRIADTV GKDVVQLYQE

     201  QLRAQGMPMV KVVALTNDTV GTYLSHCYTS DNTDSMTSGE ISEPVIGCIF

     251  GTGTNGCYME EINKITKLPQ ELRDKLIKEG KTHMIINVEW GSFDNELKHL

     301  PTTKYDVVID QKLSTNPGFH LFEKRVSGMF LGEVLRNVLV DLHSQGLLLQ

     351  QYRTKEQLPR HLTTPFQLSS EVLSHIEIDD STGLRETELS LLQSLRLPTT

     401  PTERMQIQKL VRAISRRSAY LAAVPLAAIL IKTNALNKRY HGEVEIGCDG

     451  SVVEYYPGFR SMLRHALALS PLGAEGERKV HLKIAKDGSG VGAALCALVA

     501  *