Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YCL007C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_YCL007C   1   MELAKERNGPHQKHHGQCQNHCTSPNTVRQNKTNKLLLVKKKGKLVIWRH   50
MIT_Smik_c214_2063   1   ------------------MLKSLYSSKRYTAKKNHLLVRKKREVCNIGAH   32
MIT_Suva_c94_2590   1   ----------------------------------------------MGGQ   4
WashU_Skud_Contig1939.4   1   ---------------------MLKSLYSSKHCAKKLLVSRKEKGTGNTAI   29
WashU_Smik_Contig2469.5   1   ------------------MLKSLYSSKRYTAKKNHLLVRKKREVCNIGAH   32
Symbols










SGD_Scer_YCL007C   51   I-VKKMLHIRLVVLWSHYPEQHGHGTNHYEYTNNSIAKLDAQRVSRRRRK   99
MIT_Smik_c214_2063   33   IRKKRKLYIRLVVLWGHYPEQDRHGTNHYENTDNSITKLDT---------   73
MIT_Suva_c94_2590   5   G-TLVKLHIRLVVLWSHYPEQHGHGTNHYEYTDNSIAKLKTHTDNN----   49
WashU_Skud_Contig1939.4   30   L-CGKKLHIRLIVLWSHYPKQHGHGTHHYEYTNNSITKLDTQTS------   72
WashU_Smik_Contig2469.5   33   IRKKRKLYIRLVVLWGHYPEQDRHGTNHYENTDNSITKLDT---------   73
Symbols






*:***:***.***:*. ***:*** *:***:**.:



SGD_Scer_YCL007C   100   KREAERRDYDTYKLLITLCSLLFVGPLFLKV   130
MIT_Smik_c214_2063   
   -------------------------------   
MIT_Suva_c94_2590   
   -------------------------------   
WashU_Skud_Contig1939.4   
   -------------------------------   
WashU_Smik_Contig2469.5   
   -------------------------------   
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_YCL007C:

SGD_Scer_YCL007C  Length: 131  Mon Nov  7 14:50:45 2016  Type: P  Check: 7138  ..

       1  MELAKERNGP HQKHHGQCQN HCTSPNTVRQ NKTNKLLLVK KKGKLVIWRH

      51  IVKKMLHIRL VVLWSHYPEQ HGHGTNHYEY TNNSIAKLDA QRVSRRRRKK

     101  REAERRDYDT YKLLITLCSL LFVGPLFLKV *

Protein Sequence for MIT_Smik_c214_2063:

MIT_Smik_c214_2063  Length: 74  Mon Nov  7 14:50:45 2016  Type: P  Check: 8735  ..

       1  MLKSLYSSKR YTAKKNHLLV RKKREVCNIG AHIRKKRKLY IRLVVLWGHY

      51  PEQDRHGTNH YENTDNSITK LDT*

Protein Sequence for MIT_Suva_c94_2590:

MIT_Suva_c94_2590  Length: 50  Mon Nov  7 14:50:45 2016  Type: P  Check: 6535  ..

       1  MGGQGTLVKL HIRLVVLWSH YPEQHGHGTN HYEYTDNSIA KLKTHTDNN*


Protein Sequence for WashU_Skud_Contig1939.4:

WashU_Skud_Contig1939.4  Length: 73  Mon Nov  7 14:50:45 2016  Type: P  Check: 6937  ..

       1  MLKSLYSSKH CAKKLLVSRK EKGTGNTAIL CGKKLHIRLI VLWSHYPKQH

      51  GHGTHHYEYT NNSITKLDTQ TS*

Protein Sequence for WashU_Smik_Contig2469.5:

WashU_Smik_Contig2469.5  Length: 74  Mon Nov  7 14:50:45 2016  Type: P  Check: 8735  ..

       1  MLKSLYSSKR YTAKKNHLLV RKKREVCNIG AHIRKKRKLY IRLVVLWGHY

      51  PEQDRHGTNH YENTDNSITK LDT*