Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YBR295W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_PCA1/YBR295W   1   ------------------------------------------MKPEKLFS   8
MIT_Smik_c699_5033   1   ------------------------------------------MSPKKLHV   8
MIT_Spar_c214_2157   1   -----------------------------------------MMKPKKVYF   9
WashU_Skud_Contig1849.4   1   MIRRDLDTVLYITTQKEKLTRRPRSTILNRYNRIVATSFSRQMKSKELKI   50
Symbols






*..:::



SGD_Scer_PCA1/YBR295W   9   GLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNLGLVSQRDC   58
MIT_Smik_c699_5033   9   GLRASDDECRGVHTQKDSIDTMHDNREKCCGSYIEMHSNDDPRLSPDSLY   58
MIT_Spar_c214_2157   10   GLDTSDCERRAVNSEKILTDTMQGNRGKCCNGPVEMHANDDLGLSSHGRC   59
WashU_Skud_Contig1849.4   51   RSKSKDHKCCGTNGQSIPLGIRQNKRDECCDIHAEKCTVDQSEISAGEKF   100
Symbols






:.* : .: :. . :.:* :* * : *: : .



SGD_Scer_PCA1/YBR295W   59   TNRPKITPQECLSETEQICHHGEN-RTKAGLDVD----DAETGGDHTNES   103
MIT_Smik_c699_5033   59   TNQVKQAPREYLNECKGMCYESEK-KIETVLETPSCREIAQADPNCSQKS   107
MIT_Spar_c214_2157   60   ANQAKMDPQECLSESEGMCDRREN-RIEAALNVDSCCGDNQTGHNYSDGS   108
WashU_Skud_Contig1849.4   101   AHEAKSTSQECLDDCEEMCNDDVDSVLDECRGASDCRESTLTDPAYLSKS   150
Symbols






::. * .:* *.: : :* . . . :. . *



SGD_Scer_PCA1/YBR295W   104   RVDECCAEKVNDTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMV   153
MIT_Smik_c699_5033   108   CTDECCLE-------------------------------------SSSII   120
MIT_Spar_c214_2157   109   CADECRANKGNETTAALDVESYRGDAHKGGKYPEKSCVDKCCVESSSVMV   158
WashU_Skud_Contig1849.4   151   CEEECCDE------------------------------------DSAVMA   164
Symbols






:** : *: :



SGD_Scer_PCA1/YBR295W   154   EEVTGSCEAVSSKEQLLTSFEVVPSK----SEGLQSIHDIRETTRCNTN-   198
MIT_Smik_c699_5033   121   AEVTDNCEEKCCEEQSISSFEVVLSD----CESHQPVDSTIEVPDCKPDT   166
MIT_Spar_c214_2157   159   EEITDSCEAGCCKEQLLTGLEVVSSK----CDDQQSTHDTREIPHFKADN   204
WashU_Skud_Contig1849.4   165   EEITDNCENGCCDEQPIVNLHANEYKGYLNNDNIGEAPDCMGDINQSIEN   214
Symbols






*:*..** ...** : .:.. . :. . . :



SGD_Scer_PCA1/YBR295W   199   SNQHTGKGRLCIESSDSTLKKRSCKVSRQKIEVSSKPECCNISCVERIAS   248
MIT_Smik_c699_5033   167   SSQYLAKDGCFFESRNPISKKRKCGVSGIKTDITSKSECCNISCVERLAS   216
MIT_Spar_c214_2157   205   SNQHAGKGSFCFESKNSTLKKRGCRVGRKKIELSSKAECCNISCVERLAS   254
WashU_Skud_Contig1849.4   215   DSSCYSSKLTNSTFRKRFLRSTTEILGRFDCCEVNNPPCCNTACVEHLAS   264
Symbols






... .. . :. :. . .:. *** :***::**



SGD_Scer_PCA1/YBR295W   249   RSCEKRTFKGSTNVGISGSSST-------DSLSEKFFSEQYSRMYNRYSS   291
MIT_Smik_c699_5033   217   RGCTKKISGNKTDFENYSRCAK-------ETSSEKYSSERYFEIYNRYSS   259
MIT_Spar_c214_2157   255   RSSEKKMFNRNTDVGNSGSCSS-------DSLSEKSLNEHYSTIYNRYSS   297
WashU_Skud_Contig1849.4   265   RSSKKRMSDGSLDMATDFETFRNLSTGAGGTSNEESSNERYSKIFKRYSS   314
Symbols






*.. *: . :. : .*: .*:* :::****



SGD_Scer_PCA1/YBR295W   292   ILKNLGCICNYLRTLGKESCCLPKVRFCSGEGASKKTKYSYRNSSGCLTK   341
MIT_Smik_c699_5033   260   ILKALGCICNYLRALGEESCCHPKISFCNSGETSMKSKYSYRKSSVFPIK   309
MIT_Spar_c214_2157   298   ILKNLGCICNYLRTLGKESCCLPKVRFCNGDDASIKAKYSYRNNSERLTR   347
WashU_Skud_Contig1849.4   315   ILETLGCICSYLFTIGEESCCRPRIRFSMEREASMGAKYSYRDATGCSMR   364
Symbols






**: *****.** ::*:**** *:: *. :* :*****. : :



SGD_Scer_PCA1/YBR295W   342   KKTHGDKERLS-NDNGHADFVCSKSCCTKMK-DCAVTSTISGHSSSEISR   389
MIT_Smik_c699_5033   310   KKLEKDDKSSSNHKIVPASSICSSSCCNENR-VSAVTSAIYRHSSEERTR   358
MIT_Spar_c214_2157   348   KRTQRDGNKLS-NNTAHGEFVCSKSCCNTIK-DCAITPAISGRSSTEVPK   395
WashU_Skud_Contig1849.4   365   KGSRVKKRGLYNANISTSNSSCTKECCSKKKKFAAATTTVSHCSSNDIPS   414
Symbols






* . . . . .. *:..**. : .* *.:: ** : .



SGD_Scer_PCA1/YBR295W   390   IVSMEPIENH--LNLEAGSTGTEHIVLSVSGMSCTGCESKLKKSFGALKC   437
MIT_Smik_c699_5033   359   IDSVKPIREVDLLNVETGSTGNEHVVLSVSGMTCTGCETKLKRSFAALEC   408
MIT_Spar_c214_2157   396   IVSVEPITEMGHLNLEAGSTGTEHVVLSVSGMTCTGCETKLKRSFDVLTC   445
WashU_Skud_Contig1849.4   415   ITSLKSSGETVHSDLEAGYATKEHIVLSVSGMTCTGCETKLKRSLAALKS   464
Symbols






* *::. : ::*:* : .**:*******:*****:***:*: .* .



SGD_Scer_PCA1/YBR295W   438   VHGLKTSLILSQAEFNLDLAQGSVKDVIKHLSKTTEFKYEQISNHGSTID   487
MIT_Smik_c699_5033   409   VRNLKTSLILSQAEFDLNLAQGSVKDIIRHLKRTTEFKYEQISNRGCTID   458
MIT_Spar_c214_2157   446   VHNLKTSLILSQAEFDLDLAQGSVKDVIRHLGKTTEFKYEQILNHGSTID   495
WashU_Skud_Contig1849.4   465   VQNLNTSLILSQAEFDLNISLASVKDVIKHLNRTTEFKYEQILTHGSTIN   514
Symbols






*:.*:**********:*::: .****:*:** :********* .:*.**:



SGD_Scer_PCA1/YBR295W   488   VVVPYAAKDFINEEWPQGVTELKIVERNIIRIYFDPKVIGARDLVNEGWS   537
MIT_Smik_c699_5033   459   ITVPHPANAFMNNEWPQGVTEMETIEKNIVRVYFDPKIIGARDLINKGWN   508
MIT_Spar_c214_2157   496   IVAPSIAKDFVNEKWPQGVTELKIVEKNIVRVYFDSKVIGARDLVNKGWN   545
WashU_Skud_Contig1849.4   515   IIVPSLAKDFVNSEWPEGVTELKVAGKNIVRVNFDPKVIGARDLIRKGWD   564
Symbols






: .* *: *:*.:**:****:: :**:*: **.*:******:.:**.



SGD_Scer_PCA1/YBR295W   538   VPVSIAPFSCHPTIEVGRKHLVRVGCTTALSIILTIPILVMAWAPQLREK   587
MIT_Smik_c699_5033   509   VPVNLASPSAHPTVEAGRKHLVRVGFTTILSVILTVPILVMAWAPHLREK   558
MIT_Spar_c214_2157   546   VPVNLALPSAHPTVEVGRKHLVRVGYVTALSIILTIPILVMAWTPHLREK   595
WashU_Skud_Contig1849.4   565   VPVELASPTGHPALEVGNKHLRRVGLTTLLSILLTIPILVMAWAPNLDVS   614
Symbols






***.:* : **::*.*.*** *** .* **::**:*******:*:* .



SGD_Scer_PCA1/YBR295W   588   ISTISASMVLATIIQFVIAGPFYLNALKSLIFSRLIEMDLLIVLSTSAAY   637
MIT_Smik_c699_5033   559   VSTMSVSLGLATIIQCVIAGPFYLNALKSLLFSRLIEMDLLIVLSTSAAY   608
MIT_Spar_c214_2157   596   VLTMSISMGLATIIQFVIAGPFYSNALKSLIFSRLIEMDLLIVLSTSAAY   645
WashU_Skud_Contig1849.4   615   LSTMSASMGLATIVQFAVAGPFYSNALKSLVFSRLIDMDLLIVVSTSAAY   664
Symbols






: *:* *: ****:* .:***** ******:*****:******:******



SGD_Scer_PCA1/YBR295W   638   IFSIVSFGYFVVGRPLSTEQFFETSSLLVTLIMVGRFVSELARHRAVKSI   687
MIT_Smik_c699_5033   609   IFSIVSFVYFAAGHPLPTEQFFETSSLLVTLIMVGRFVSELARHRAVSSI   658
MIT_Spar_c214_2157   646   IFSIVSFGYFVTGRPLSTEQFFETSSLLVTLIMVGRFVSELARHKAVKSI   695
WashU_Skud_Contig1849.4   665   IFSVVSFGYFVAGQPLSTEQFFETSSLLVTLIMVGRFVSELARYRAVKSI   714
Symbols






***:*** **..*:**.**************************::**.**



SGD_Scer_PCA1/YBR295W   688   SVRSLQASSAILVDKTGKETEINIRLLQYGDIFKVLPDSRIPTDGTVISG   737
MIT_Smik_c699_5033   659   SVRSLQVSSAIILDESGNETKIDIRLLQHGDVFKVVPDSRIPTDGTVISG   708
MIT_Spar_c214_2157   696   SVRSLQASSAILVDEAGNETEIDIRLLQYGDIFKVLPDSKIPTDGTVISG   745
WashU_Skud_Contig1849.4   715   SLRSLQVSSAIVINEDHTETEIDIRLLQYGDVFKAVPDSRIPTDGTVISG   764
Symbols






*:****.****:::: .**:*:*****:**:**.:***:**********



SGD_Scer_PCA1/YBR295W   738   SSEVDEALITGESMPVPKKCQSIVVAGSVNGTGTLFVKLSKLPGNNTIST   787
MIT_Smik_c699_5033   709   SSEVDEATITGESMPVPKTCQSTVVAGSLNITGTLFVKLTKLPANNTINI   758
MIT_Spar_c214_2157   746   SSEVDEALITGESMPVPKKCQSIVVAGSVNGTSTLFVKLIKLPGNNTIST   795
WashU_Skud_Contig1849.4   765   SSEANEAMITGESKPVLKKFQSTVIAGSVNGSGTLVVRLTKLPGNNTVSM   814
Symbols






***.:** ***** ** *. ** *:***:* :.**.*:* ***.***:.



SGD_Scer_PCA1/YBR295W   788   IATMVDEAKLTKPKIQNIADKIASYFVPTIIGITVVTFCVWIAVGIRVEK   837
MIT_Smik_c699_5033   759   IATMVDEAKLTKPKIQNIADQIASYFVPLIIGITVVTFCVWVGIGINVKK   808
MIT_Spar_c214_2157   796   IATMVDEAKLTKPKIQNFADRIASYFVPTIIGITVVTFFVWIGVGINVKK   845
WashU_Skud_Contig1849.4   815   IATMVDEAKLSKPRIQNIADKIAGYFVPFIIGITIITFCIWIGVGINVSK   864
Symbols






**********:**:***:**:**.**** *****::** :*:.:**.*.*



SGD_Scer_PCA1/YBR295W   838   QSRSDAVIQAIIYAITVLIVSCPCVIGLAVPIVFVIASGVAAKRGVIFKS   887
MIT_Smik_c699_5033   809   QSRSDSVIQAIIYAITVLIVSCPCAIGLAVPMVFVIANGVAAKRGVIFKS   858
MIT_Spar_c214_2157   846   QSRSDAVIQATIYAITVLIVSCPCAIGLAVPMVFVIASGVAAKRGVIFKS   895
WashU_Skud_Contig1849.4   865   KPRSDAAIQATIYAITVLIVSCPCAIGLAVPMVFVVASGVAAKRGVVFKS   914
Symbols






:.***:.*** *************.******:***:*.********:***



SGD_Scer_PCA1/YBR295W   888   AESIEVAHNTSHVVFDKTGTLTEGKLTVVHETVRGDRHNSQSLLLGLTEG   937
MIT_Smik_c699_5033   859   ADSIEAAHNTSHVIFDKTGTLTEGKLTVVHEIMKDDNLDAQSQLLGLIEG   908
MIT_Spar_c214_2157   896   AESIEAAHNTSHVVFDKTGTLTEGKLTVVREIIGNDRLNSQSLLLGLTEG   945
WashU_Skud_Contig1849.4   915   AMSIEVAHNVSDVVFDKTGTLTEGKLSVVREIMGGNQDNIRSLLLGLVEG   964
Symbols






* ***.***.*.*:************:**:* : .:. : :* **** **



SGD_Scer_PCA1/YBR295W   938   IKHPVSMAIASYLKEKGVSAQNVSNTKAVTGKRVEGTSYSGLKLQGGNCR   987
MIT_Smik_c699_5033   909   IKHPVSIAVASYLKEQKVRARRVHDTKALTGKGVEGTSHSGSKLQGGNSR   958
MIT_Spar_c214_2157   946   IKHPVSIAIASYLKEQSVSAQNVSDTKAVTGKGVEGCSHSGLKLQGGNCR   995
WashU_Skud_Contig1849.4   965   MNHPVSIAIASYLKDRGVSASNASDTKVMTGKGIEGISHSGLKLRGGNSR   1014
Symbols






::****:*:*****:: * * .. :**.:*** :** *:** **:***.*



SGD_Scer_PCA1/YBR295W   988   WLGHNNDPDVRKALEQGYSVFCFSVNGSVTAVYALEDSLRADAVSTINLL   1037
MIT_Smik_c699_5033   959   WIGNSDDPDVQKFLEQGYTVFCFSVDGSLTAIYALEDSLRADALATVNSL   1008
MIT_Spar_c214_2157   996   WLGHSDDPDVREALDQGYSVFCFSVNGSLTAVYALEDSLRADAVSTINSL   1045
WashU_Skud_Contig1849.4   1015   WLAFTGNSRVQEALSQGHTVFCFSVNASLAAIYALDDSLRVDAIFTVNAL   1064
Symbols






*:. ..:. *:: *.**::******:.*::*:***:****.**: *:* *



SGD_Scer_PCA1/YBR295W   1038   RQRGISLHILSGDDDGAVRSMAARLGIESSNIRSHATPAEKSEYIKDIVE   1087
MIT_Smik_c699_5033   1009   RQRGISIHILSGDDDGAVRSLAARLAIESSNIRSHATPAEKGEYIKRILE   1058
MIT_Spar_c214_2157   1046   RQRGISLHILSGDDDGAVRSLAARLEIESSNIRSHATPAEKGEYIKDIVE   1095
WashU_Skud_Contig1849.4   1065   RQKGISIHILSGDDDGAVRSLASRLEIDSANIRSHATPADKRDYVRNLLK   1114
Symbols






**:***:*************:*:** *:*:*********:* :*:: :::



SGD_Scer_PCA1/YBR295W   1088   GRNCDSSSQSKRPVVVFCGDGTNDAIGLTQATIGVHINEGSEVAKLAADV   1137
MIT_Smik_c699_5033   1059   GVNSESSPQSERPVVVFCGDGTNDAIALTQATIGVHINQGSEVSQLAADV   1108
MIT_Spar_c214_2157   1096   GRNFDNSSQSKRPVVVFCGDGTNDAIALAQATIGVHINEGSEVAKLAADV   1145
WashU_Skud_Contig1849.4   1115   KTEDEGSSQSKAPVVIFCGDGTNDAVALAQATIGVHINEGSEVSKLAADV   1164
Symbols






: :.*.**: ***:*********:.*:*********:****::*****



SGD_Scer_PCA1/YBR295W   1138   VMLKPKLNNILTMITVSQKAMFRVKLNFLWSFTYNLFAILLAAGAFVDFH   1187
MIT_Smik_c699_5033   1109   VMLKPKLINILIMMTVSRKAMFRVKLNFMWSFTYNLFAILLAAGAFVNFH   1158
MIT_Spar_c214_2157   1146   VMLKPKLNSILTMMTVSRKAMFKVKLNFIWSFTYNLFAILLAAGAFVDFH   1195
WashU_Skud_Contig1849.4   1165   VTMRPNLACILTMIDVSQKAMFRVKLNFAWSFIYNLFAILLAAGAFVNVH   1214
Symbols






* ::*:* ** *: **:****:***** *** **************:.*



SGD_Scer_PCA1/YBR295W   1188   IPPEYAGLGELVSILPVIFVAILLRYAKI---------   1216
MIT_Smik_c699_5033   1159   IPPEYAGLGELVSILPVILVATLLRYASI---------   1187
MIT_Spar_c214_2157   1196   IPPEYAGLGELVSILPVIFVATLLRYASI---------   1224
WashU_Skud_Contig1849.4   1215   IPPEYAGLGELVSILPVILIAFLLRYSKIHSPNAGSVS   1252
Symbols






******************::* ****:.*



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_PCA1/YBR295W:

SGD_Scer_PCA1/YBR295W  Length: 1217  Mon Nov  7 14:50:30 2016  Type: P  Check: 5116  ..

       1  MKPEKLFSGL GTSDGEYGVV NSENISIDAM QDNRGECHRR SIEMHANDNL

      51  GLVSQRDCTN RPKITPQECL SETEQICHHG ENRTKAGLDV DDAETGGDHT

     101  NESRVDECCA EKVNDTETGL DVDSCCGDAQ TGGDHTNESC VDGCCVRDSS

     151  VMVEEVTGSC EAVSSKEQLL TSFEVVPSKS EGLQSIHDIR ETTRCNTNSN

     201  QHTGKGRLCI ESSDSTLKKR SCKVSRQKIE VSSKPECCNI SCVERIASRS

     251  CEKRTFKGST NVGISGSSST DSLSEKFFSE QYSRMYNRYS SILKNLGCIC

     301  NYLRTLGKES CCLPKVRFCS GEGASKKTKY SYRNSSGCLT KKKTHGDKER

     351  LSNDNGHADF VCSKSCCTKM KDCAVTSTIS GHSSSEISRI VSMEPIENHL

     401  NLEAGSTGTE HIVLSVSGMS CTGCESKLKK SFGALKCVHG LKTSLILSQA

     451  EFNLDLAQGS VKDVIKHLSK TTEFKYEQIS NHGSTIDVVV PYAAKDFINE

     501  EWPQGVTELK IVERNIIRIY FDPKVIGARD LVNEGWSVPV SIAPFSCHPT

     551  IEVGRKHLVR VGCTTALSII LTIPILVMAW APQLREKIST ISASMVLATI

     601  IQFVIAGPFY LNALKSLIFS RLIEMDLLIV LSTSAAYIFS IVSFGYFVVG

     651  RPLSTEQFFE TSSLLVTLIM VGRFVSELAR HRAVKSISVR SLQASSAILV

     701  DKTGKETEIN IRLLQYGDIF KVLPDSRIPT DGTVISGSSE VDEALITGES

     751  MPVPKKCQSI VVAGSVNGTG TLFVKLSKLP GNNTISTIAT MVDEAKLTKP

     801  KIQNIADKIA SYFVPTIIGI TVVTFCVWIA VGIRVEKQSR SDAVIQAIIY

     851  AITVLIVSCP CVIGLAVPIV FVIASGVAAK RGVIFKSAES IEVAHNTSHV

     901  VFDKTGTLTE GKLTVVHETV RGDRHNSQSL LLGLTEGIKH PVSMAIASYL

     951  KEKGVSAQNV SNTKAVTGKR VEGTSYSGLK LQGGNCRWLG HNNDPDVRKA

    1001  LEQGYSVFCF SVNGSVTAVY ALEDSLRADA VSTINLLRQR GISLHILSGD

    1051  DDGAVRSMAA RLGIESSNIR SHATPAEKSE YIKDIVEGRN CDSSSQSKRP

    1101  VVVFCGDGTN DAIGLTQATI GVHINEGSEV AKLAADVVML KPKLNNILTM

    1151  ITVSQKAMFR VKLNFLWSFT YNLFAILLAA GAFVDFHIPP EYAGLGELVS

    1201  ILPVIFVAIL LRYAKI*

Protein Sequence for MIT_Smik_c699_5033:

MIT_Smik_c699_5033  Length: 1188  Mon Nov  7 14:50:30 2016  Type: P  Check: 4008  ..

       1  MSPKKLHVGL RASDDECRGV HTQKDSIDTM HDNREKCCGS YIEMHSNDDP

      51  RLSPDSLYTN QVKQAPREYL NECKGMCYES EKKIETVLET PSCREIAQAD

     101  PNCSQKSCTD ECCLESSSII AEVTDNCEEK CCEEQSISSF EVVLSDCESH

     151  QPVDSTIEVP DCKPDTSSQY LAKDGCFFES RNPISKKRKC GVSGIKTDIT

     201  SKSECCNISC VERLASRGCT KKISGNKTDF ENYSRCAKET SSEKYSSERY

     251  FEIYNRYSSI LKALGCICNY LRALGEESCC HPKISFCNSG ETSMKSKYSY

     301  RKSSVFPIKK KLEKDDKSSS NHKIVPASSI CSSSCCNENR VSAVTSAIYR

     351  HSSEERTRID SVKPIREVDL LNVETGSTGN EHVVLSVSGM TCTGCETKLK

     401  RSFAALECVR NLKTSLILSQ AEFDLNLAQG SVKDIIRHLK RTTEFKYEQI

     451  SNRGCTIDIT VPHPANAFMN NEWPQGVTEM ETIEKNIVRV YFDPKIIGAR

     501  DLINKGWNVP VNLASPSAHP TVEAGRKHLV RVGFTTILSV ILTVPILVMA

     551  WAPHLREKVS TMSVSLGLAT IIQCVIAGPF YLNALKSLLF SRLIEMDLLI

     601  VLSTSAAYIF SIVSFVYFAA GHPLPTEQFF ETSSLLVTLI MVGRFVSELA

     651  RHRAVSSISV RSLQVSSAII LDESGNETKI DIRLLQHGDV FKVVPDSRIP

     701  TDGTVISGSS EVDEATITGE SMPVPKTCQS TVVAGSLNIT GTLFVKLTKL

     751  PANNTINIIA TMVDEAKLTK PKIQNIADQI ASYFVPLIIG ITVVTFCVWV

     801  GIGINVKKQS RSDSVIQAII YAITVLIVSC PCAIGLAVPM VFVIANGVAA

     851  KRGVIFKSAD SIEAAHNTSH VIFDKTGTLT EGKLTVVHEI MKDDNLDAQS

     901  QLLGLIEGIK HPVSIAVASY LKEQKVRARR VHDTKALTGK GVEGTSHSGS

     951  KLQGGNSRWI GNSDDPDVQK FLEQGYTVFC FSVDGSLTAI YALEDSLRAD

    1001  ALATVNSLRQ RGISIHILSG DDDGAVRSLA ARLAIESSNI RSHATPAEKG

    1051  EYIKRILEGV NSESSPQSER PVVVFCGDGT NDAIALTQAT IGVHINQGSE

    1101  VSQLAADVVM LKPKLINILI MMTVSRKAMF RVKLNFMWSF TYNLFAILLA

    1151  AGAFVNFHIP PEYAGLGELV SILPVILVAT LLRYASI*

Protein Sequence for MIT_Spar_c214_2157:

MIT_Spar_c214_2157  Length: 1225  Mon Nov  7 14:50:30 2016  Type: P  Check: 4250  ..

       1  MMKPKKVYFG LDTSDCERRA VNSEKILTDT MQGNRGKCCN GPVEMHANDD

      51  LGLSSHGRCA NQAKMDPQEC LSESEGMCDR RENRIEAALN VDSCCGDNQT

     101  GHNYSDGSCA DECRANKGNE TTAALDVESY RGDAHKGGKY PEKSCVDKCC

     151  VESSSVMVEE ITDSCEAGCC KEQLLTGLEV VSSKCDDQQS THDTREIPHF

     201  KADNSNQHAG KGSFCFESKN STLKKRGCRV GRKKIELSSK AECCNISCVE

     251  RLASRSSEKK MFNRNTDVGN SGSCSSDSLS EKSLNEHYST IYNRYSSILK

     301  NLGCICNYLR TLGKESCCLP KVRFCNGDDA SIKAKYSYRN NSERLTRKRT

     351  QRDGNKLSNN TAHGEFVCSK SCCNTIKDCA ITPAISGRSS TEVPKIVSVE

     401  PITEMGHLNL EAGSTGTEHV VLSVSGMTCT GCETKLKRSF DVLTCVHNLK

     451  TSLILSQAEF DLDLAQGSVK DVIRHLGKTT EFKYEQILNH GSTIDIVAPS

     501  IAKDFVNEKW PQGVTELKIV EKNIVRVYFD SKVIGARDLV NKGWNVPVNL

     551  ALPSAHPTVE VGRKHLVRVG YVTALSIILT IPILVMAWTP HLREKVLTMS

     601  ISMGLATIIQ FVIAGPFYSN ALKSLIFSRL IEMDLLIVLS TSAAYIFSIV

     651  SFGYFVTGRP LSTEQFFETS SLLVTLIMVG RFVSELARHK AVKSISVRSL

     701  QASSAILVDE AGNETEIDIR LLQYGDIFKV LPDSKIPTDG TVISGSSEVD

     751  EALITGESMP VPKKCQSIVV AGSVNGTSTL FVKLIKLPGN NTISTIATMV

     801  DEAKLTKPKI QNFADRIASY FVPTIIGITV VTFFVWIGVG INVKKQSRSD

     851  AVIQATIYAI TVLIVSCPCA IGLAVPMVFV IASGVAAKRG VIFKSAESIE

     901  AAHNTSHVVF DKTGTLTEGK LTVVREIIGN DRLNSQSLLL GLTEGIKHPV

     951  SIAIASYLKE QSVSAQNVSD TKAVTGKGVE GCSHSGLKLQ GGNCRWLGHS

    1001  DDPDVREALD QGYSVFCFSV NGSLTAVYAL EDSLRADAVS TINSLRQRGI

    1051  SLHILSGDDD GAVRSLAARL EIESSNIRSH ATPAEKGEYI KDIVEGRNFD

    1101  NSSQSKRPVV VFCGDGTNDA IALAQATIGV HINEGSEVAK LAADVVMLKP

    1151  KLNSILTMMT VSRKAMFKVK LNFIWSFTYN LFAILLAAGA FVDFHIPPEY

    1201  AGLGELVSIL PVIFVATLLR YASI*

Protein Sequence for WashU_Skud_Contig1849.4:

WashU_Skud_Contig1849.4  Length: 1253  Mon Nov  7 14:50:30 2016  Type: P  Check: 2153  ..

       1  MIRRDLDTVL YITTQKEKLT RRPRSTILNR YNRIVATSFS RQMKSKELKI

      51  RSKSKDHKCC GTNGQSIPLG IRQNKRDECC DIHAEKCTVD QSEISAGEKF

     101  AHEAKSTSQE CLDDCEEMCN DDVDSVLDEC RGASDCREST LTDPAYLSKS

     151  CEEECCDEDS AVMAEEITDN CENGCCDEQP IVNLHANEYK GYLNNDNIGE

     201  APDCMGDINQ SIENDSSCYS SKLTNSTFRK RFLRSTTEIL GRFDCCEVNN

     251  PPCCNTACVE HLASRSSKKR MSDGSLDMAT DFETFRNLST GAGGTSNEES

     301  SNERYSKIFK RYSSILETLG CICSYLFTIG EESCCRPRIR FSMEREASMG

     351  AKYSYRDATG CSMRKGSRVK KRGLYNANIS TSNSSCTKEC CSKKKKFAAA

     401  TTTVSHCSSN DIPSITSLKS SGETVHSDLE AGYATKEHIV LSVSGMTCTG

     451  CETKLKRSLA ALKSVQNLNT SLILSQAEFD LNISLASVKD VIKHLNRTTE

     501  FKYEQILTHG STINIIVPSL AKDFVNSEWP EGVTELKVAG KNIVRVNFDP

     551  KVIGARDLIR KGWDVPVELA SPTGHPALEV GNKHLRRVGL TTLLSILLTI

     601  PILVMAWAPN LDVSLSTMSA SMGLATIVQF AVAGPFYSNA LKSLVFSRLI

     651  DMDLLIVVST SAAYIFSVVS FGYFVAGQPL STEQFFETSS LLVTLIMVGR

     701  FVSELARYRA VKSISLRSLQ VSSAIVINED HTETEIDIRL LQYGDVFKAV

     751  PDSRIPTDGT VISGSSEANE AMITGESKPV LKKFQSTVIA GSVNGSGTLV

     801  VRLTKLPGNN TVSMIATMVD EAKLSKPRIQ NIADKIAGYF VPFIIGITII

     851  TFCIWIGVGI NVSKKPRSDA AIQATIYAIT VLIVSCPCAI GLAVPMVFVV

     901  ASGVAAKRGV VFKSAMSIEV AHNVSDVVFD KTGTLTEGKL SVVREIMGGN

     951  QDNIRSLLLG LVEGMNHPVS IAIASYLKDR GVSASNASDT KVMTGKGIEG

    1001  ISHSGLKLRG GNSRWLAFTG NSRVQEALSQ GHTVFCFSVN ASLAAIYALD

    1051  DSLRVDAIFT VNALRQKGIS IHILSGDDDG AVRSLASRLE IDSANIRSHA

    1101  TPADKRDYVR NLLKKTEDEG SSQSKAPVVI FCGDGTNDAV ALAQATIGVH

    1151  INEGSEVSKL AADVVTMRPN LACILTMIDV SQKAMFRVKL NFAWSFIYNL

    1201  FAILLAAGAF VNVHIPPEYA GLGELVSILP VILIAFLLRY SKIHSPNAGS

    1251  VS*