Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YBR243C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_ALG7/YBR243C   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
MIT_Smik_c696_4868   1   MLRFFSFIVVTCLIYYSKSQGLSALVAAVGFGIAGYFATDWLIPRVGKSF   50
MIT_Spar_c214_1984   1   MLRLFSLVVITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
MIT_Suva_c878_2138   
   --------------------------------------------------   
WashU_Scas_Contig597.7   1   --MFQKLLLLLALVLIYCSNKNSAIITAIGFSILGYFVTNFLIPKVGPSF   48
WashU_Sklu_Contig2080.1   1   --MNHLALLSIAIGLLYWSNHNSILFAATGFSIVGYVATNWLIPRVSSSF   48
WashU_Skud_Contig1651.4   1   MLRLCSLVLVTCLIYYSKNQGPSALVAAVGFGIAGYFATDMLIPRVGKSF   50
Symbols










SGD_Scer_ALG7/YBR243C   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
MIT_Smik_c696_4868   51   IKIGLFGKDLSKPGRPVLPETIGAIPAGVYLFVMFIYIPFIFYKYMVITT   100
MIT_Spar_c214_1984   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
MIT_Suva_c878_2138   
   --------------------------------------------------   
WashU_Scas_Contig597.7   49   IKIGLFGKDLSKPGKPVLPETIGAVSAIVYLFVVLSYIPFIFYKYMVVTT   98
WashU_Sklu_Contig2080.1   49   IKIGLHGKDMSKPGKPLLPETIGAISATVYLFVMFFYVPFIFYKYLVVMT   98
WashU_Skud_Contig1651.4   51   IKIGLFGKDLSKPGRPVLPETIGAIPAGVYLFVMFIYIPFIFYKYMVVTT   100
Symbols










SGD_Scer_ALG7/YBR243C   101   SGGGHR-DVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLF   149
MIT_Smik_c696_4868   101   SGGGHR-DVSVIEGKDMDSTIFPHDKLSEYLSAILCLESTVLLGVADDLF   149
MIT_Spar_c214_1984   101   SGGGHR-DVSVVEDDGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLF   149
MIT_Suva_c878_2138   
   --------------------------------------------------   
WashU_Scas_Contig597.7   99   SGGGERGNVIPSHEESLNSTIFPHDRLCEYLSSILCLQSTILLGIADDLF   148
WashU_Sklu_Contig2080.1   99   SGGGHR---DVSVLESNDEYLFPHGKLSEYLSAVLCLESTVLLGVADDLF   145
WashU_Skud_Contig1651.4   101   SGGGHR-DISVVEDNDTNFSIFPHDKLSEYLSAILCLESTVLLGIADDLF   149
Symbols










SGD_Scer_ALG7/YBR243C   150   DLRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTS--VDL   197
MIT_Smik_c696_4868   150   DLRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMEHWLKKTS--VDL   197
MIT_Spar_c214_1984   150   DLRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMEHWLKKTS--VDL   197
MIT_Suva_c878_2138   
   --------------------------------------------------   
WashU_Scas_Contig597.7   149   DLRWRHKFFLPIIGSIPLLVIYYVDFGVTYVLIPGFIQRWMQLTASTIDL   198
WashU_Sklu_Contig2080.1   146   DLRWRHKFFLPAVAAIPLLVVYYVDFGVTHVLIPDFLRKSWGFSRSAIDL   195
WashU_Skud_Contig1651.4   150   DLRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLVPEFMEHWLKKTS--VDL   197
Symbols










SGD_Scer_ALG7/YBR243C   198   GLWYYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSM   247
MIT_Smik_c696_4868   198   GLWYYVYMAAMAIFCPNSINILAGVNGLEVGQCIVLAVLALLNDLLYFSM   247
MIT_Spar_c214_1984   198   GLWYYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSM   247
MIT_Suva_c878_2138   1   -------------------------------------------------M   1
WashU_Scas_Contig597.7   199   GGLYYVYMAAMGIFCPNSINILAGVNGLEVGQSIVLGILELLNDTLYLTL   248
WashU_Sklu_Contig2080.1   196   GAFYYCYMGAVAIFCPNSINILAGVNGLEVGQSIVLGFIFLINDVLYLTM   245
WashU_Skud_Contig1651.4   198   GLWYYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAVLALFNDLLYFSM   247
Symbols






:



SGD_Scer_ALG7/YBR243C   248   GPLATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVF   297
MIT_Smik_c696_4868   248   GPLATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVF   297
MIT_Spar_c214_1984   248   GPLATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVF   297
MIT_Suva_c878_2138   2   GPPATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVF   51
WashU_Scas_Contig597.7   249   GSKQARAAHRFSAVLIIPFLGVSLALWKWNRWPAKVFVGDTYCYFAGMVF   298
WashU_Sklu_Contig2080.1   246   GPEAAKESHRFSAVLIIPFLGVSLALWNYNHWPAKVFVGDTYCYFAGMVF   295
WashU_Skud_Contig1651.4   248   GPLATRESHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVF   297
Symbols






*. :: :*******************::*:***.***************



SGD_Scer_ALG7/YBR243C   298   AVVGILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDG   347
MIT_Smik_c696_4868   298   AVVGILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNETDG   347
MIT_Spar_c214_1984   298   AVVGILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDG   347
MIT_Suva_c878_2138   52   AVVGILGHFSKTMLLLFIPQIINFIYSCPQLFKLVPCPRHRLPKFNEKDG   101
WashU_Scas_Contig597.7   299   AVVGILGHFSKTILLLFIPQILNFLYSCPQLFKIVPCPRHRLPHFNEEDG   348
WashU_Sklu_Contig2080.1   296   AVVGILGHFSKTTLLFFIPQVLNFIYSVPQLFHLLPCPRHRLPRFNEEDG   345
WashU_Skud_Contig1651.4   298   AVVGILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDG   347
Symbols






************ **:****::**:** ****:::********:*** **



SGD_Scer_ALG7/YBR243C   348   LMYPSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNE--IISTSNMT   395
MIT_Smik_c696_4868   348   LMYPSRTNLKEEPPKSFFKPILKLLYCLNLIDVEVDENNE--MISISNMT   395
MIT_Spar_c214_1984   348   LMYPSRANLKEEPPKRIFKPVLKLLYCLHLIDLEFDENNE--IISTSNMT   395
MIT_Suva_c878_2138   102   LMYPSRANLKEEPPKAFFKPILRLLHHFTLIDLEFDDNNE--ITSASNMT   149
WashU_Scas_Contig597.7   349   LMYPSVANLKDEPPKSWFIPILRLLNCFKLIQLEFDDKDKSKIISCSNMT   398
WashU_Sklu_Contig2080.1   346   LMYPSKADFANKAPNRIVTGVLKTMSNLNLIYLECDKHGN--ITHCSNMT   393
WashU_Skud_Contig1651.4   348   LMYPSRANLKEEPPKAFFKPILKLLYCLNLIDLEFDGNNE--MTSTSNMT   395
Symbols






***** ::: ::.*: . :*: : : ** :* * :.: : ****



SGD_Scer_ALG7/YBR243C   396   LINLTLVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLW   445
MIT_Smik_c696_4868   396   LINLALVWFGPMREDKLCNTILQLQFCIGVLALIGRHAIGAILFGHDNLW   445
MIT_Spar_c214_1984   396   LINLTLVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLW   445
MIT_Suva_c878_2138   150   LINLTLVWFGPMREDKLCNRILQLQFCMGILALIGRHAIGAIIFGHDNLW   199
WashU_Scas_Contig597.7   399   LINLTLVWFGPMREDRLCNRILQIQFLIGLLALFARHAGGAMLFGHDNLW   448
WashU_Sklu_Contig2080.1   394   LINLVLVWFGPLREDKLCFTILLIQFSIGITAIAARHAIGSMVFGNDNLW   443
WashU_Skud_Contig1651.4   396   LINLTLVWFGPMREDKLCNTILQLQFCIGILALIGRHAIGAIIFGHDNLW   445
Symbols






****.******:***:** ** :** :*: *: .*** *:::**:****



SGD_Scer_ALG7/YBR243C   446   TVR   448
MIT_Smik_c696_4868   446   TVR   448
MIT_Spar_c214_1984   446   TVR   448
MIT_Suva_c878_2138   200   TVR   202
WashU_Scas_Contig597.7   449   T--   449
WashU_Sklu_Contig2080.1   444   SVV   446
WashU_Skud_Contig1651.4   446   TVR   448
Symbols






:



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_ALG7/YBR243C:

SGD_Scer_ALG7/YBR243C  Length: 449  Mon Nov  7 14:49:20 2016  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for MIT_Smik_c696_4868:

MIT_Smik_c696_4868  Length: 449  Mon Nov  7 14:49:20 2016  Type: P  Check: 7771  ..

       1  MLRFFSFIVV TCLIYYSKSQ GLSALVAAVG FGIAGYFATD WLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAGVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV IEGKDMDSTI FPHDKLSEYL SAILCLESTV LLGVADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMEHWL KKTSVDLGLW

     201  YYVYMAAMAI FCPNSINILA GVNGLEVGQC IVLAVLALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNETDGLMY

     351  PSRTNLKEEP PKSFFKPILK LLYCLNLIDV EVDENNEMIS ISNMTLINLA

     401  LVWFGPMRED KLCNTILQLQ FCIGVLALIG RHAIGAILFG HDNLWTVR*


Protein Sequence for MIT_Spar_c214_1984:

MIT_Spar_c214_1984  Length: 449  Mon Nov  7 14:49:20 2016  Type: P  Check: 6594  ..

       1  MLRLFSLVVI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDDGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMEHWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKRIFKPVLK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for MIT_Suva_c878_2138:

MIT_Suva_c878_2138  Length: 203  Mon Nov  7 14:49:20 2016  Type: P  Check: 6976  ..

       1  MGPPATRDSH RFSAVLIIPF LGVSLALWKW NRWPATVFVG DTYCYFAGMV

      51  FAVVGILGHF SKTMLLLFIP QIINFIYSCP QLFKLVPCPR HRLPKFNEKD

     101  GLMYPSRANL KEEPPKAFFK PILRLLHHFT LIDLEFDDNN EITSASNMTL

     151  INLTLVWFGP MREDKLCNRI LQLQFCMGIL ALIGRHAIGA IIFGHDNLWT

     201  VR*

Protein Sequence for WashU_Scas_Contig597.7:

WashU_Scas_Contig597.7  Length: 450  Mon Nov  7 14:49:20 2016  Type: P  Check: 609  ..

       1  MFQKLLLLLA LVLIYCSNKN SAIITAIGFS ILGYFVTNFL IPKVGPSFIK

      51  IGLFGKDLSK PGKPVLPETI GAVSAIVYLF VVLSYIPFIF YKYMVVTTSG

     101  GGERGNVIPS HEESLNSTIF PHDRLCEYLS SILCLQSTIL LGIADDLFDL

     151  RWRHKFFLPI IGSIPLLVIY YVDFGVTYVL IPGFIQRWMQ LTASTIDLGG

     201  LYYVYMAAMG IFCPNSINIL AGVNGLEVGQ SIVLGILELL NDTLYLTLGS

     251  KQARAAHRFS AVLIIPFLGV SLALWKWNRW PAKVFVGDTY CYFAGMVFAV

     301  VGILGHFSKT ILLLFIPQIL NFLYSCPQLF KIVPCPRHRL PHFNEEDGLM

     351  YPSVANLKDE PPKSWFIPIL RLLNCFKLIQ LEFDDKDKSK IISCSNMTLI

     401  NLTLVWFGPM REDRLCNRIL QIQFLIGLLA LFARHAGGAM LFGHDNLWT*


Protein Sequence for WashU_Sklu_Contig2080.1:

WashU_Sklu_Contig2080.1  Length: 447  Mon Nov  7 14:49:20 2016  Type: P  Check: 3791  ..

       1  MNHLALLSIA IGLLYWSNHN SILFAATGFS IVGYVATNWL IPRVSSSFIK

      51  IGLHGKDMSK PGKPLLPETI GAISATVYLF VMFFYVPFIF YKYLVVMTSG

     101  GGHRDVSVLE SNDEYLFPHG KLSEYLSAVL CLESTVLLGV ADDLFDLRWR

     151  HKFFLPAVAA IPLLVVYYVD FGVTHVLIPD FLRKSWGFSR SAIDLGAFYY

     201  CYMGAVAIFC PNSINILAGV NGLEVGQSIV LGFIFLINDV LYLTMGPEAA

     251  KESHRFSAVL IIPFLGVSLA LWNYNHWPAK VFVGDTYCYF AGMVFAVVGI

     301  LGHFSKTTLL FFIPQVLNFI YSVPQLFHLL PCPRHRLPRF NEEDGLMYPS

     351  KADFANKAPN RIVTGVLKTM SNLNLIYLEC DKHGNITHCS NMTLINLVLV

     401  WFGPLREDKL CFTILLIQFS IGITAIAARH AIGSMVFGND NLWSVV*


Protein Sequence for WashU_Skud_Contig1651.4:

WashU_Skud_Contig1651.4  Length: 449  Mon Nov  7 14:49:20 2016  Type: P  Check: 7367  ..

       1  MLRLCSLVLV TCLIYYSKNQ GPSALVAAVG FGIAGYFATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAGVY LFVMFIYIPF IFYKYMVVTT

     101  SGGGHRDISV VEDNDTNFSI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LVPEFMEHWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAVLALFN DLLYFSMGPL

     251  ATRESHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKAFFKPILK LLYCLNLIDL EFDGNNEMTS TSNMTLINLT

     401  LVWFGPMRED KLCNTILQLQ FCIGILALIG RHAIGAIIFG HDNLWTVR*