Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YBR019C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_GAL10/YBR019C   1   MTAQLQSESTSKIVLVTGGAGYIGSHTVVELIENGYDCVVADNLSNSTYD   50
MIT_Smik_c144_1225   1   MTVQLQSESTVRTVLVTGGAGYIGSHTVVELVENGYECVVVDNLSNSSYD   50
MIT_Spar_c197_1064   1   MTAQLQSESTPKIVLVTGGAGYIGSHTVVELIENGYECVVADNLSNSTYD   50
MIT_Suva_c808_21484   1   MTAQLQTTSNAKTVLVTGGAGYIGSHTVVELIENGYECVVVDNLSNSSYD   50
WashU_Sbay_Contig523.5   1   MTAQLQTTSNAKTVLVTGGAGYIGSHTVVELIENGYECVVVDNLSNSSYD   50
WashU_Scas_Contig522.5   1   ------MTTAAKKVLVTGGAGYIGSHTVVELIENGYECVIVDNLCNSSYD   44
WashU_Smik_Contig2699.3   1   MTVQLQSESTVRTVLVTGGAGYIGSHTVVELVENGYECVVVDNLSNSSYD   50
Symbols






: : ******************:****:**:.***.**:**



SGD_Scer_GAL10/YBR019C   51   SVARLEVLTKHHIPFYEVDLCDRKGLEKVFKEYKIDSVIHFAGLKAVGES   100
MIT_Smik_c144_1225   51   SIARLEILTKHHIPFYEIDLRDRECLRKVFEEHKIDSVIHFAGLKAVGES   100
MIT_Spar_c197_1064   51   SIARLEILTKHHIPFYEIDLRDRKGLEKVFKEHKIDSVIHFAGLKAVGES   100
MIT_Suva_c808_21484   51   SVARLEILTKHHIPFHKVDLCDREGLEKVFKEHEIDSVIHFAGLKAVGES   100
WashU_Sbay_Contig523.5   51   SVARLEILTKHHIPFHKVDLCDREGLEKVFKEHEIDSVIHFAGLKAVGES   100
WashU_Scas_Contig522.5   45   AVARLEILTKHHIPFYKVDLCDAEGLEKVFQEHKIDSVIHFAGLKAVGES   94
WashU_Smik_Contig2699.3   51   SIARLEILTKHHIPFYEIDLRDRECLRKVFEEHKIDSVIHFAGLKAVGES   100
Symbols






::****:********:::** * : *.***:*::****************



SGD_Scer_GAL10/YBR019C   101   TQIPLRYYHNNILGTVVLLELMQQYNVSKFVFSSSATVYGDATRFPNMIP   150
MIT_Smik_c144_1225   101   TQIPLRYYHNNILGTLVLLELMQQYKVSNFVFSSSATVYGDATRFPNMIP   150
MIT_Spar_c197_1064   101   TQIPLRYYHNNILGTVVLLELMQQYKVSKFVFSSSATVYGDATRFPNMIP   150
MIT_Suva_c808_21484   101   TQIPLRYYHNNILGTLVLLELMQQYKVSKFVFSSSATVYGDATRFPDMIP   150
WashU_Sbay_Contig523.5   101   TQIPLRYYHNNILGTLVLLELMQQYKVSKFVFSSSATVYGDATRFPDMIP   150
WashU_Scas_Contig522.5   95   TQIPLRYYHNNILGTLVLLELMGKYDVKKLVFSSSATVYGDATRFPDMIP   144
WashU_Smik_Contig2699.3   101   TQIPLRYYHNNILGTLVLLELMQQYKVSNFVFSSSATVYGDATRFPNMIP   150
Symbols






***************:****** :*.*.::****************:***



SGD_Scer_GAL10/YBR019C   151   IPEECPLGPTNPYGHTKYAIENILNDLYNSDKKSWKFAILRYFNPIGAHP   200
MIT_Smik_c144_1225   151   IPEECPLGPTNPYGHTKYAIENILNDLYNSDKKNWKFAILRYFNPIGAHP   200
MIT_Spar_c197_1064   151   IPEECPLGPTNPYGHTKYAIENILNDLYSSDKKRWKFAILRYFNPIGAHP   200
MIT_Suva_c808_21484   151   IPEECPLGPTNPYGNTKYTIEKILNDLYNSDKASWKFSILRYFNPIGAHP   200
WashU_Sbay_Contig523.5   151   IPEECPLGPTNPYGNTKYTIEKILNDLYNSDKASWKFSILRYFNPIGAHP   200
WashU_Scas_Contig522.5   145   IPEECPLGPTNPYGQTKLAIEHILHDLYNSDNKTWKFAILRYFNPIGAHP   194
WashU_Smik_Contig2699.3   151   IPEECPLGPTNPYGHTKYAIENILNDLYNSDKKNWKFAILRYFNPIGAHP   200
Symbols






**************:** :**:**:***.**: ***:************



SGD_Scer_GAL10/YBR019C   201   SGLIGEDPLGIPNNLLPYMAQVAVGRREKLYIFGDDYDSRDGTPIRDYIH   250
MIT_Smik_c144_1225   201   SGLIGEDPLGIPNNLLPYMAQVSVGRREKLYIFGNDYDSRDGTPIRDYIH   250
MIT_Spar_c197_1064   201   SGLIGEDPLGIPNNLLPYMAQVAVGRREKLYIFGDDYDSRDGTPIRDYIH   250
MIT_Suva_c808_21484   201   SGLIGEDPLGIPNNLLPYMAQVAVGRREKLYIFGDDYDSRDGTPIRDYIH   250
WashU_Sbay_Contig523.5   201   SGLIGEDPLGIPNNLLPYMAQVAVGRREKLYIFGDDYDSRDGTPIRDYIH   250
WashU_Scas_Contig522.5   195   SGLIGEDPLGIPNNLLPYMAQVAVGRREKLFVFGNDYDSRDGTPIRDYIH   244
WashU_Smik_Contig2699.3   201   SGLIGEDPLGIPNNLLPYMAQVSVGRREKLYIFGNDYDSRDGTPIRDYIH   250
Symbols






**********************:*******::**:***************



SGD_Scer_GAL10/YBR019C   251   VVDLAKGHIAALQYLEAYNENEGLCREWNLGSGKGSTVFEVYHAFCKASG   300
MIT_Smik_c144_1225   251   VVDLAKGHIAALKYLEVYNENEGLCREWNLGSGKGSTVFEVYRAFCKASG   300
MIT_Spar_c197_1064   251   VVDLAKGHIAALKYLEAYNGNEGLCREWNLGSGKGSTVFEVYHAFCKASG   300
MIT_Suva_c808_21484   251   VVDLAKGHIAALKYLDAYNPKEGLCREWNLGSGKGSTVFEVYRAFCKASG   300
WashU_Sbay_Contig523.5   251   VVDLAKGHIAALKYLDAYNPKEGLCREWNLGSGKGSTVFEVYRAFCKASG   300
WashU_Scas_Contig522.5   245   VVDLAKGHIASLKYLDAQDQSQGICREWNLGSGTGSTVLEVYRAFCDASG   294
WashU_Smik_Contig2699.3   251   VVDLAKGHIAALKYLEVYNENEGLCREWNLGSGKGSTVFEVYRAFCKASG   300
Symbols






**********:*:**:. : .:*:*********.****:***:***.***



SGD_Scer_GAL10/YBR019C   301   IDLPYKVTGRRAGDVLNLTAKPDRAKRELKWQTELQVEDSCKDLWKWTTE   350
MIT_Smik_c144_1225   301   VALPYEVTARRAGDVLNLTAKPDRAKRELKWQTKLQVEDSCKDLWKWTTE   350
MIT_Spar_c197_1064   301   INLPYEVTGRRAGDVLNLTAKPDRAKRELKWQTELQVEDSCKDLWKWATE   350
MIT_Suva_c808_21484   301   IDLPYEVTGRRAGDVLNLTAKPDRAKRELKWQTELQVEDSCKDLWKWATE   350
WashU_Sbay_Contig523.5   301   IDLPYEVTGRRAGDVLNLTAKPDRAKRELKWQTELQVEDSCKDLWKWATE   350
WashU_Scas_Contig522.5   295   IEIPYEITGRRAGDVLNLTAKPDRAKRELKWQTELDVAAACRDLWKWSTD   344
WashU_Smik_Contig2699.3   301   VALPYEVTARRAGDVLNLTAKPDRAKRELKWQTKLQVEDSCKDLWKWTTE   350
Symbols






: :**::*.************************:*:* :*:*****:*:



SGD_Scer_GAL10/YBR019C   351   NPFGYQLRGVEARFSAEDMRYDARFVTIGAGTRFQATFANLGASIVDLKV   400
MIT_Smik_c144_1225   351   NPFGYQLRGVEARFSTEDMHYDARFVTIGAGTRFQATFANLGATIVDLKV   400
MIT_Spar_c197_1064   351   NPFGYQLRGVEARFSTEDMRYDARFVTIGAGTRFQATFANLGASIVDLKV   400
MIT_Suva_c808_21484   351   NPFGYQLKGVEARFATEEMSYDARFVTIGAGTRFQATIANLGATIVDLKV   400
WashU_Sbay_Contig523.5   351   NPFGYQLKGVEARFATEEMSYDARFVTIGAGTRFQATIANLGATIVDLKV   400
WashU_Scas_Contig522.5   345   NPFGYQLKGIDAKFGTPDEEFDGRFVTIGAGSRFQATIANLGATLADLKV   394
WashU_Smik_Contig2699.3   351   NPFGYQLRGVEARFSTEDMHYDARFVTIGAGTRFQATFANLGATIVDLKV   400
Symbols






*******:*::*:*.: : :*.********:*****:*****::.****



SGD_Scer_GAL10/YBR019C   401   NGQSVVLGYENEEGYLNPDSAYIGATIGRYANRISKGKFSLCNKDYQLTV   450
MIT_Smik_c144_1225   401   DGQSVVLGYENEKGYLNSDSAYVGATIGRYANRIAKGKFSLGNNIYQLTI   450
MIT_Spar_c197_1064   401   DGQSVVLGYENEKGYLDPDSAYIGATIGRYANRIAKGKFSLRNKNYQLTV   450
MIT_Suva_c808_21484   401   DGQSVVLGYENEEGYLNPDSSYIGATIGRYANRIAKGKFNLGGKDYQLTV   450
WashU_Sbay_Contig523.5   401   DGQSVVLGYENEEGYLNPDSSYIGATIGRYANRIAKGKFNLGGKDYQLTV   450
WashU_Scas_Contig522.5   395   DGQSVVLNYKDEAGYLSKDSCYIGATIGRYANRIAHGKFNLNGKDYQLTI   444
WashU_Smik_Contig2699.3   401   DGQSVVLGYENEKGYLNSDSAYVGATIGRYANRIAKGKFSLGNNIYQLTI   450
Symbols






:******.*::* ***. **.*:***********::***.* .: ****:



SGD_Scer_GAL10/YBR019C   451   NNGVNANHSSIGSFHRKRFLGPIIQNPSKDVFTAEYMLIDNEKDTEFPGD   500
MIT_Smik_c144_1225   451   NNGTNANHGSIGSFHMKRFLGPVVQNPSKDVFIAEYMLVDKGEDTEFPGD   500
MIT_Spar_c197_1064   451   NNGVNANHSSISSFHRKRFLGPIVQNPSKDVFTAEYMLIDNERDTEFPGD   500
MIT_Suva_c808_21484   451   NNGINANHGSIGSFHVKRFLGPIVQNPSKDVFTAEYILIDNGKDTEFPGD   500
WashU_Sbay_Contig523.5   451   NNGINANHGSIGSFHVKRFLGPIVQNPSKDVFTAEYILIDNGKDTEFPGD   500
WashU_Scas_Contig522.5   445   NNGVNANHGSIGSFHVKRFLGPILKNPSKDIFTAEYALVDKSENSEFPGS   494
WashU_Smik_Contig2699.3   451   NNGTNANHGSIGSFHMKRFLGPVVQNPSKDVFIAEYMLVDKGEDTEFPGD   500
Symbols






*** ****.**.*** ******:::*****:* *** *:*: .::****.



SGD_Scer_GAL10/YBR019C   501   LLVTIQYTVNVAQKSLEMVYKGKLTAGEATPINLTNHSYFNLNKPYG-DT   549
MIT_Smik_c144_1225   501   LLVTVQYTLNVTEKSLEVKYQGKLTAGEATPINLTNHSYFNLNKPRE-DT   549
MIT_Spar_c197_1064   501   LMVTVQYTVNVAKKSLEIVYKGKVTGGEETPINLTNHTYFNLNKPYG-DS   549
MIT_Suva_c808_21484   501   LQVTVQYTLNVAKKSLEIEYKGKLTAGEATPLNLTNHTYFNLNKPHE-DT   549
WashU_Sbay_Contig523.5   501   LQVTVQYTLNVAKKSLEIEYKGKLTAGEATPLNLTNHTYFNLNKPHE-DT   549
WashU_Scas_Contig522.5   495   LTVTVLYTVNVATKTLDIEYTGNVEG-EATPINMTNHTYFNLNKLNGPES   543
WashU_Smik_Contig2699.3   501   LLVTVQYTLNVTEKSLEVKYQGKLTAGEATPINLTNHSYFNLNKPRE-DT   549
Symbols






* **: **:**: *:*:: * *:: . * **:*:***:****** ::



SGD_Scer_GAL10/YBR019C   550   IEGTEIMVRSKKSVDVDKNMIPTGNIVDREIATFNSTKPTVLGPKNPQFD   599
MIT_Smik_c144_1225   550   IEGTVIRVCSKKSVDVDKNMIPTGNIVDRDIATFDSTKPTVLGPIEPQFD   599
MIT_Spar_c197_1064   550   IEGTEIMVRSKKSVDVDKNMIPTGNTVNREIATFDSAKPTVLGPKNPQFD   599
MIT_Suva_c808_21484   550   IDGTEIKVVSKRSVDVDKNVIPTGKIVDRNIATFDCSKPTILGPKDPQYD   599
WashU_Sbay_Contig523.5   550   IDGTEIKVVSKRSVDVDKNVIPTGKIVDRNIATFDCSKPTILGPKDPQYD   599
WashU_Scas_Contig522.5   544   IEGTEIQVISKKSIDVDANTIPTGSIIDRDIATYNDAKPTVLGKRSPDYD   593
WashU_Smik_Contig2699.3   550   IEGTVIRVCSKKSVDVDKNMIPTGNIVDRDIATFDSTKPTVLGPIEPQFD   599
Symbols






*:** * * **:*:*** * ****. ::*:***:: :***:** .*::*



SGD_Scer_GAL10/YBR019C   600   CCFVVDENAKPSQINTLNNELTLIVKAFHPDSNITLEVLSTEPTYQFYTG   649
MIT_Smik_c144_1225   600   CCFVVDEDVKPRQVNTLNNELTLIFKAFHPDSNITLEVLSTEPTFQLYTG   649
MIT_Spar_c197_1064   600   YCFVVDENPKPNQINTLNNELILILKAFNPDSNITLEVLSTEPTYQFYTG   649
MIT_Suva_c808_21484   600   YCFVVDENAKPKKIDTSNNELTLVAKAFHPDSKITLEVLSTEPTYQVYTG   649
WashU_Sbay_Contig523.5   600   YCFVVDENAKPKKIDTSNNELTLVAKAFHPDSKITLEVLSTEPTYQVYTG   649
WashU_Scas_Contig522.5   594   YCFVIDEKEVPTEVNTSSKKLKLVTTAYHPDSNIKLEVLTTEPSYQVYTG   643
WashU_Smik_Contig2699.3   600   CCFVVDEDVKPRQVNTLNNELTLIFKAFHPDSNITLEVLSTEPTFQLYTG   649
Symbols






***:**. * :::* .::* *: .*::***:*.****:***::*.***



SGD_Scer_GAL10/YBR019C   650   DFLSAGYEARQGFAIEPGRYIDAINQENWKDCVTLKNGETYGSKIVYRFS   699
MIT_Smik_c144_1225   650   DFLSAGYTARQGFAIEPGRYIDAINQEDWKDCVTLKDGETYGSKIVYRFS   699
MIT_Spar_c197_1064   650   DFLSAGYTARQGFAIEPGRYIDAINQENWKDCVILKRGETYGSKIIYRFS   699
MIT_Suva_c808_21484   650   DFLSAGYTARQGFAVEPGRYVDAINRKEWKDCVILKHGETYGSKIVYRFS   699
WashU_Sbay_Contig523.5   650   DFLSAGYTARQGFAVEPGRYVDAINRKEWKDCVILKHGETYGSKIVYRFS   699
WashU_Scas_Contig522.5   644   DWLCAGYHPRQGFAVEPGRYVDAINN-KYKECVTLKPGETYGSKIQYRFS   692
WashU_Smik_Contig2699.3   650   DFLSAGYTARQGFAIEPGRYIDAINQEDWKDCVTLKDGETYGSKIVYRFS   699
Symbols






*:*.*** .*****:*****:****. .:*:** ** ******** ****



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_GAL10/YBR019C:

SGD_Scer_GAL10/YBR019C  Length: 700  Mon Nov  7 14:44:14 2016  Type: P  Check: 3384  ..

       1  MTAQLQSEST SKIVLVTGGA GYIGSHTVVE LIENGYDCVV ADNLSNSTYD

      51  SVARLEVLTK HHIPFYEVDL CDRKGLEKVF KEYKIDSVIH FAGLKAVGES

     101  TQIPLRYYHN NILGTVVLLE LMQQYNVSKF VFSSSATVYG DATRFPNMIP

     151  IPEECPLGPT NPYGHTKYAI ENILNDLYNS DKKSWKFAIL RYFNPIGAHP

     201  SGLIGEDPLG IPNNLLPYMA QVAVGRREKL YIFGDDYDSR DGTPIRDYIH

     251  VVDLAKGHIA ALQYLEAYNE NEGLCREWNL GSGKGSTVFE VYHAFCKASG

     301  IDLPYKVTGR RAGDVLNLTA KPDRAKRELK WQTELQVEDS CKDLWKWTTE

     351  NPFGYQLRGV EARFSAEDMR YDARFVTIGA GTRFQATFAN LGASIVDLKV

     401  NGQSVVLGYE NEEGYLNPDS AYIGATIGRY ANRISKGKFS LCNKDYQLTV

     451  NNGVNANHSS IGSFHRKRFL GPIIQNPSKD VFTAEYMLID NEKDTEFPGD

     501  LLVTIQYTVN VAQKSLEMVY KGKLTAGEAT PINLTNHSYF NLNKPYGDTI

     551  EGTEIMVRSK KSVDVDKNMI PTGNIVDREI ATFNSTKPTV LGPKNPQFDC

     601  CFVVDENAKP SQINTLNNEL TLIVKAFHPD SNITLEVLST EPTYQFYTGD

     651  FLSAGYEARQ GFAIEPGRYI DAINQENWKD CVTLKNGETY GSKIVYRFS*


Protein Sequence for MIT_Smik_c144_1225:

MIT_Smik_c144_1225  Length: 700  Mon Nov  7 14:44:14 2016  Type: P  Check: 4779  ..

       1  MTVQLQSEST VRTVLVTGGA GYIGSHTVVE LVENGYECVV VDNLSNSSYD

      51  SIARLEILTK HHIPFYEIDL RDRECLRKVF EEHKIDSVIH FAGLKAVGES

     101  TQIPLRYYHN NILGTLVLLE LMQQYKVSNF VFSSSATVYG DATRFPNMIP

     151  IPEECPLGPT NPYGHTKYAI ENILNDLYNS DKKNWKFAIL RYFNPIGAHP

     201  SGLIGEDPLG IPNNLLPYMA QVSVGRREKL YIFGNDYDSR DGTPIRDYIH

     251  VVDLAKGHIA ALKYLEVYNE NEGLCREWNL GSGKGSTVFE VYRAFCKASG

     301  VALPYEVTAR RAGDVLNLTA KPDRAKRELK WQTKLQVEDS CKDLWKWTTE

     351  NPFGYQLRGV EARFSTEDMH YDARFVTIGA GTRFQATFAN LGATIVDLKV

     401  DGQSVVLGYE NEKGYLNSDS AYVGATIGRY ANRIAKGKFS LGNNIYQLTI

     451  NNGTNANHGS IGSFHMKRFL GPVVQNPSKD VFIAEYMLVD KGEDTEFPGD

     501  LLVTVQYTLN VTEKSLEVKY QGKLTAGEAT PINLTNHSYF NLNKPREDTI

     551  EGTVIRVCSK KSVDVDKNMI PTGNIVDRDI ATFDSTKPTV LGPIEPQFDC

     601  CFVVDEDVKP RQVNTLNNEL TLIFKAFHPD SNITLEVLST EPTFQLYTGD

     651  FLSAGYTARQ GFAIEPGRYI DAINQEDWKD CVTLKDGETY GSKIVYRFS*


Protein Sequence for MIT_Spar_c197_1064:

MIT_Spar_c197_1064  Length: 700  Mon Nov  7 14:44:14 2016  Type: P  Check: 2625  ..

       1  MTAQLQSEST PKIVLVTGGA GYIGSHTVVE LIENGYECVV ADNLSNSTYD

      51  SIARLEILTK HHIPFYEIDL RDRKGLEKVF KEHKIDSVIH FAGLKAVGES

     101  TQIPLRYYHN NILGTVVLLE LMQQYKVSKF VFSSSATVYG DATRFPNMIP

     151  IPEECPLGPT NPYGHTKYAI ENILNDLYSS DKKRWKFAIL RYFNPIGAHP

     201  SGLIGEDPLG IPNNLLPYMA QVAVGRREKL YIFGDDYDSR DGTPIRDYIH

     251  VVDLAKGHIA ALKYLEAYNG NEGLCREWNL GSGKGSTVFE VYHAFCKASG

     301  INLPYEVTGR RAGDVLNLTA KPDRAKRELK WQTELQVEDS CKDLWKWATE

     351  NPFGYQLRGV EARFSTEDMR YDARFVTIGA GTRFQATFAN LGASIVDLKV

     401  DGQSVVLGYE NEKGYLDPDS AYIGATIGRY ANRIAKGKFS LRNKNYQLTV

     451  NNGVNANHSS ISSFHRKRFL GPIVQNPSKD VFTAEYMLID NERDTEFPGD

     501  LMVTVQYTVN VAKKSLEIVY KGKVTGGEET PINLTNHTYF NLNKPYGDSI

     551  EGTEIMVRSK KSVDVDKNMI PTGNTVNREI ATFDSAKPTV LGPKNPQFDY

     601  CFVVDENPKP NQINTLNNEL ILILKAFNPD SNITLEVLST EPTYQFYTGD

     651  FLSAGYTARQ GFAIEPGRYI DAINQENWKD CVILKRGETY GSKIIYRFS*


Protein Sequence for MIT_Suva_c808_21484:

MIT_Suva_c808_21484  Length: 700  Mon Nov  7 14:44:14 2016  Type: P  Check: 3288  ..

       1  MTAQLQTTSN AKTVLVTGGA GYIGSHTVVE LIENGYECVV VDNLSNSSYD

      51  SVARLEILTK HHIPFHKVDL CDREGLEKVF KEHEIDSVIH FAGLKAVGES

     101  TQIPLRYYHN NILGTLVLLE LMQQYKVSKF VFSSSATVYG DATRFPDMIP

     151  IPEECPLGPT NPYGNTKYTI EKILNDLYNS DKASWKFSIL RYFNPIGAHP

     201  SGLIGEDPLG IPNNLLPYMA QVAVGRREKL YIFGDDYDSR DGTPIRDYIH

     251  VVDLAKGHIA ALKYLDAYNP KEGLCREWNL GSGKGSTVFE VYRAFCKASG

     301  IDLPYEVTGR RAGDVLNLTA KPDRAKRELK WQTELQVEDS CKDLWKWATE

     351  NPFGYQLKGV EARFATEEMS YDARFVTIGA GTRFQATIAN LGATIVDLKV

     401  DGQSVVLGYE NEEGYLNPDS SYIGATIGRY ANRIAKGKFN LGGKDYQLTV

     451  NNGINANHGS IGSFHVKRFL GPIVQNPSKD VFTAEYILID NGKDTEFPGD

     501  LQVTVQYTLN VAKKSLEIEY KGKLTAGEAT PLNLTNHTYF NLNKPHEDTI

     551  DGTEIKVVSK RSVDVDKNVI PTGKIVDRNI ATFDCSKPTI LGPKDPQYDY

     601  CFVVDENAKP KKIDTSNNEL TLVAKAFHPD SKITLEVLST EPTYQVYTGD

     651  FLSAGYTARQ GFAVEPGRYV DAINRKEWKD CVILKHGETY GSKIVYRFS*


Protein Sequence for WashU_Sbay_Contig523.5:

WashU_Sbay_Contig523.5  Length: 700  Mon Nov  7 14:44:14 2016  Type: P  Check: 3288  ..

       1  MTAQLQTTSN AKTVLVTGGA GYIGSHTVVE LIENGYECVV VDNLSNSSYD

      51  SVARLEILTK HHIPFHKVDL CDREGLEKVF KEHEIDSVIH FAGLKAVGES

     101  TQIPLRYYHN NILGTLVLLE LMQQYKVSKF VFSSSATVYG DATRFPDMIP

     151  IPEECPLGPT NPYGNTKYTI EKILNDLYNS DKASWKFSIL RYFNPIGAHP

     201  SGLIGEDPLG IPNNLLPYMA QVAVGRREKL YIFGDDYDSR DGTPIRDYIH

     251  VVDLAKGHIA ALKYLDAYNP KEGLCREWNL GSGKGSTVFE VYRAFCKASG

     301  IDLPYEVTGR RAGDVLNLTA KPDRAKRELK WQTELQVEDS CKDLWKWATE

     351  NPFGYQLKGV EARFATEEMS YDARFVTIGA GTRFQATIAN LGATIVDLKV

     401  DGQSVVLGYE NEEGYLNPDS SYIGATIGRY ANRIAKGKFN LGGKDYQLTV

     451  NNGINANHGS IGSFHVKRFL GPIVQNPSKD VFTAEYILID NGKDTEFPGD

     501  LQVTVQYTLN VAKKSLEIEY KGKLTAGEAT PLNLTNHTYF NLNKPHEDTI

     551  DGTEIKVVSK RSVDVDKNVI PTGKIVDRNI ATFDCSKPTI LGPKDPQYDY

     601  CFVVDENAKP KKIDTSNNEL TLVAKAFHPD SKITLEVLST EPTYQVYTGD

     651  FLSAGYTARQ GFAVEPGRYV DAINRKEWKD CVILKHGETY GSKIVYRFS*


Protein Sequence for WashU_Scas_Contig522.5:

WashU_Scas_Contig522.5  Length: 693  Mon Nov  7 14:44:14 2016  Type: P  Check: 5694  ..

       1  MTTAAKKVLV TGGAGYIGSH TVVELIENGY ECVIVDNLCN SSYDAVARLE

      51  ILTKHHIPFY KVDLCDAEGL EKVFQEHKID SVIHFAGLKA VGESTQIPLR

     101  YYHNNILGTL VLLELMGKYD VKKLVFSSSA TVYGDATRFP DMIPIPEECP

     151  LGPTNPYGQT KLAIEHILHD LYNSDNKTWK FAILRYFNPI GAHPSGLIGE

     201  DPLGIPNNLL PYMAQVAVGR REKLFVFGND YDSRDGTPIR DYIHVVDLAK

     251  GHIASLKYLD AQDQSQGICR EWNLGSGTGS TVLEVYRAFC DASGIEIPYE

     301  ITGRRAGDVL NLTAKPDRAK RELKWQTELD VAAACRDLWK WSTDNPFGYQ

     351  LKGIDAKFGT PDEEFDGRFV TIGAGSRFQA TIANLGATLA DLKVDGQSVV

     401  LNYKDEAGYL SKDSCYIGAT IGRYANRIAH GKFNLNGKDY QLTINNGVNA

     451  NHGSIGSFHV KRFLGPILKN PSKDIFTAEY ALVDKSENSE FPGSLTVTVL

     501  YTVNVATKTL DIEYTGNVEG EATPINMTNH TYFNLNKLNG PESIEGTEIQ

     551  VISKKSIDVD ANTIPTGSII DRDIATYNDA KPTVLGKRSP DYDYCFVIDE

     601  KEVPTEVNTS SKKLKLVTTA YHPDSNIKLE VLTTEPSYQV YTGDWLCAGY

     651  HPRQGFAVEP GRYVDAINNK YKECVTLKPG ETYGSKIQYR FS*


Protein Sequence for WashU_Smik_Contig2699.3:

WashU_Smik_Contig2699.3  Length: 700  Mon Nov  7 14:44:14 2016  Type: P  Check: 4779  ..

       1  MTVQLQSEST VRTVLVTGGA GYIGSHTVVE LVENGYECVV VDNLSNSSYD

      51  SIARLEILTK HHIPFYEIDL RDRECLRKVF EEHKIDSVIH FAGLKAVGES

     101  TQIPLRYYHN NILGTLVLLE LMQQYKVSNF VFSSSATVYG DATRFPNMIP

     151  IPEECPLGPT NPYGHTKYAI ENILNDLYNS DKKNWKFAIL RYFNPIGAHP

     201  SGLIGEDPLG IPNNLLPYMA QVSVGRREKL YIFGNDYDSR DGTPIRDYIH

     251  VVDLAKGHIA ALKYLEVYNE NEGLCREWNL GSGKGSTVFE VYRAFCKASG

     301  VALPYEVTAR RAGDVLNLTA KPDRAKRELK WQTKLQVEDS CKDLWKWTTE

     351  NPFGYQLRGV EARFSTEDMH YDARFVTIGA GTRFQATFAN LGATIVDLKV

     401  DGQSVVLGYE NEKGYLNSDS AYVGATIGRY ANRIAKGKFS LGNNIYQLTI

     451  NNGTNANHGS IGSFHMKRFL GPVVQNPSKD VFIAEYMLVD KGEDTEFPGD

     501  LLVTVQYTLN VTEKSLEVKY QGKLTAGEAT PINLTNHSYF NLNKPREDTI

     551  EGTVIRVCSK KSVDVDKNMI PTGNIVDRDI ATFDSTKPTV LGPIEPQFDC

     601  CFVVDEDVKP RQVNTLNNEL TLIFKAFHPD SNITLEVLST EPTFQLYTGD

     651  FLSAGYTARQ GFAIEPGRYI DAINQEDWKD CVTLKDGETY GSKIVYRFS*