Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YAL002W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_VPS8/YAL002W   1   --------MEQNGLDHDSRSSIDTTINDTQKTFLEFRSYTQLSEKLASSS   42
MIT_Smik_c1032_301   1   --------MEQNGLDHDSRSSIDTANNDTQKTFLEFRSYTQLSEKLASNP   42
MIT_Spar_c218_186   1   --------MEQNGLDHDSRSSIDTTINDTQKTFLEFRSYTQLSEKLASNP   42
MIT_Suva_c957_346   1   --------MEQNGLDHDSRSSIDTIN-DTQKSFLEFRSYTHLSEKLASNT   41
WashU_Sbay_Contig669.13   1   --------MEQNGLDHDSRSSIDTIN-DTQKSFLEFRSYTHLSEKLASNT   41
WashU_Scas_Contig670.26   1   MVKYNVTIQYSNKLKHSSNGDMEDEAPLSGQNIETMSMGNNTVQLGSSST   50
WashU_Sklu_Contig2306.5   1   --------MSDESIHSVATGLSCEPSFLEQRAQTRLTTRSRPNSNTSQFP   42
WashU_Smik_Contig2700.2   
   --------------------------------------------------   
Symbols










SGD_Scer_VPS8/YAL002W   43   SYTAPPLNEDGP----------------KGVASAVSQGSESVVSWTTLTH   76
MIT_Smik_c1032_301   43   SYATSRPNDDSS----------------KGVATAVSQGSGSIISWTTLTH   76
MIT_Spar_c218_186   43   FYATPHPDDDSL----------------KGVASAVSQGSESVVSWTTLTH   76
MIT_Suva_c957_346   42   AFPASQPEEDGP----------------KGVATAISQGSESVVSWTSLTH   75
WashU_Sbay_Contig669.13   42   AFPASQPEEDGP----------------KGVATAISQGSESVVSWTSLTH   75
WashU_Scas_Contig670.26   51   VDQLPFDDLQTPSKSFNDSLASTVPSISNSLFFKETAHSNSLIKWTTLNQ   100
WashU_Sklu_Contig2306.5   43   SSPVHQTFSACN------------------PFDESSDNYITPVNWASLQQ   74
WashU_Smik_Contig2700.2   
   --------------------------------------------------   
Symbols










SGD_Scer_VPS8/YAL002W   77   VYSILGAYGGPTCLYPTATYFLMGTSKGCVLIFNYNEHLQTILVPTLSED   126
MIT_Smik_c1032_301   77   VYSILGAYGGPTCLYPTTTYFLMGTSKGYVLIFNYNEHLQTILVPTLFED   126
MIT_Spar_c218_186   77   VYSILGAYGGPTCLYPTATYFLMGTSKGCVLIFNYNEHLQTILVPTLSED   126
MIT_Suva_c957_346   76   VYSILGAYGGPTCLYPTTTYFLMGTSRGSVLIFNFNEHLQTILVPTLSED   125
WashU_Sbay_Contig669.13   76   VYSILGAYGGPTCLYPTTTYFLMGTSRGSVLIFNFNEHLQTILVPTLSED   125
WashU_Scas_Contig670.26   101   IYSLVSAYGGPTCILPTKSYFVLGTSKGALLIFNFKEFLQTILLPQISDK   150
WashU_Sklu_Contig2306.5   75   VYPMLSIYGGATCIYPAQSYFALGTSRACILILNHKQILQTILGPQD---   121
WashU_Smik_Contig2700.2   1   ----------------------MGTSKGYVLIFNYNEHLQTILVPTLFED   28
Symbols






:***:. :**:*.:: ***** *



SGD_Scer_VPS8/YAL002W   127   PSIHSIRSPVKSIVICSDGTHVAASYETGNICIWNLNVGYR---VKPTSE   173
MIT_Smik_c1032_301   127   PSAHPIRSSVKSIVICSDGTHVAASYESGNICLWNLNVGYR---VKTASE   173
MIT_Spar_c218_186   127   PSAHSIRSPVKSIVICSDGTHVAASYENGSICIWNLNVGYR---VKPVSE   173
MIT_Suva_c957_346   126   PAAHSIRSPVKSIAVCSDGTHVAASYESGSICVWNLNVGYR---VKIVHE   172
WashU_Sbay_Contig669.13   126   PAAHSIRSPVKSIAVCSDGTHVAASYESGSICVWNLNVGYR---VKIVHE   172
WashU_Scas_Contig670.26   151   E--TLLRSAVKTIAVATDGTYLAAAYQSGDVFIWNLNLKTTNEDIPFFEN   198
WashU_Sklu_Contig2306.5   122   ---ENFRSPVERISVSSDGTHVAASYQSGDVFIWNLNGGES---------   159
WashU_Smik_Contig2700.2   29   PSAHSIRSSVKSIVICSDGTHVAASYESGNICLWNLNVGYR---VKTASE   75
Symbols






:**.*: * :.:***::**:*:.*.: :****



SGD_Scer_VPS8/YAL002W   174   PTNGMTPTPALPAVLHIDDHVNKEITGLDFFGARHTALIVSDRTGKVSLY   223
MIT_Smik_c1032_301   174   PTNGMSPTPALPAILHIDDHLNKEVTGLDFFGARHTALIVSDRTGKVSLY   223
MIT_Spar_c218_186   174   PTNSMTPTPALPAVLHIDDHLNKEITGLDFFGARHTALIVSDRTGRVSLY   223
MIT_Suva_c957_346   173   PTSGMTPTPSIPAILHIDDHLNKEITGLDFFGTRHTALIVSDRTGRISLY   222
WashU_Sbay_Contig669.13   173   PTSGMTPTPSIPAILHIDDHLNKEITGLDFFGTRHTALIVSDRTGRISLY   222
WashU_Scas_Contig670.26   199   RNEPLSSVNSLDAILHITYHKDSDINGMGFLHNRHTALIVSDSSSRITFH   248
WashU_Sklu_Contig2306.5   160   ------HERQLLPILNITTHKGCNINGLGFVGERHTAMVISDDSGAVLYH   203
WashU_Smik_Contig2700.2   76   PTNGMSPTPALPAILHIDDHLNKEVTGLDFFGARHTALIVSDRTGKVSLY   125
Symbols






: .:*:* * . ::.*:.*. ****:::** :. : :



SGD_Scer_VPS8/YAL002W   224   NGYRRGFWQLVYNSKKILDVNSSKEKLIRSKLSPLISREK---ISTNLLS   270
MIT_Smik_c1032_301   224   NGYRRGFWQLVYNSKKILNVNSFNEKLIRSKLSPLISQEK---ISTNLLS   270
MIT_Spar_c218_186   224   NGYRRGFWQLVYNSKKILDVNSFDEKLIRSKLSPLISREK---ISTNLLS   270
MIT_Suva_c957_346   223   NGYRRGFWQLVYNSSKILDLNSPNERLIRSRLSPLITQDK---NSLNLLS   269
WashU_Sbay_Contig669.13   223   NGYRRGFWQLVYNSSKILDLNSPNERLIRSRLSPLITQDK---NSLNLLS   269
WashU_Scas_Contig670.26   249   NGFRNSFWNLTYSSKDILSLSPNEKLFCSMMALPPRDSNF---KSGNLLA   295
WashU_Sklu_Contig2306.5   204   TGFRNHLWQLTYRTKVILNVANEGQILQTAISPATEVSGNKILRELHLLA   253
WashU_Smik_Contig2700.2   126   NGYRRGFWQLVYNSKKILNVNSFNEKLIRSKLSPLISQEK---ISTNLLS   172
Symbols






.*:*. :*:*.* :. **.: : : . . :**:



SGD_Scer_VPS8/YAL002W   271   VLTTTHFALILLSPHVSLMFQETVEPSVQNS---LVVNSSISWTQNCSRV   317
MIT_Smik_c1032_301   271   VLTTTHFALISLSPHVSLIFQETIEPSIRNS---LVVNSSISWTQNCSMV   317
MIT_Spar_c218_186   271   VLTTTHFALISLSPHVSLIFQETIEPSVQNS---LVVNSSISWTQNCSRV   317
MIT_Suva_c957_346   270   VLTNTHFALLSLSPHVSLVCQEPIESSIRHS---LVMNSSISWTYNSSRV   316
WashU_Sbay_Contig669.13   270   VLTNTHFALLSLSPHVSLVCQEPIESSIRHS---LVMNSSISWTYNSSRV   316
WashU_Scas_Contig670.26   296   ILTNINFVILSTSPHPEILFQENLHDAKSNTTEGPIYNSSIAWSTDRSQI   345
WashU_Sklu_Contig2306.5   254   TVSQDSFALISMNPHLVTQYLEKAPKNDSGIS--SPFRANISWGHSGTKV   301
WashU_Smik_Contig2700.2   173   VLTTTHFALISLSPHVSLIFQETIEPSIRNS---LVVNSSISWTQNCSMV   219
Symbols






:: *.:: .** * .:.*:* . : :



SGD_Scer_VPS8/YAL002W   318   AYSVNNKISVISIS-----SSDFNVQSASHSPEFAESILSIQWIDQLLLG   362
MIT_Smik_c1032_301   318   AYSVNNKISIISLS-----LSDLNVQSATHSSEFAESILSIQWIDQLLLG   362
MIT_Spar_c218_186   318   AYSVNNKISIISMS-----SSDLNVQSAKHSPEFAESILSIQWIDQLLLG   362
MIT_Suva_c957_346   317   AYSVNNKISVISMS-----LSDLNIQSIKHSSEFPESILSIQWIDQFLLG   361
WashU_Sbay_Contig669.13   317   AYSVNNKISVISMS-----LSDLNIQSIKHSSEFPESILSIQWIDQFLLG   361
WashU_Scas_Contig670.26   346   AYCINKTVFLFGLSNQ---VTPLEFVITRRTSTFTESILSLQWLNPRLLG   392
WashU_Sklu_Contig2306.5   302   AYSLNKSISVFVLTGEKVNEEKLVNISKRETWNCQEEIINVQWVSEDLIG   351
WashU_Smik_Contig2700.2   220   AYSVNNKISIISLS-----LSDLNVQSATHSSEFAESILSIQWIDQLLLG   264
Symbols






**.:*:.: :: :: : .: *.*:.:**:. *:*



SGD_Scer_VPS8/YAL002W   363   VLTISHQFLVLHPQHDFKILLRLDFLIHDLMIPPNKYFVISRRSFYLLTN   412
MIT_Smik_c1032_301   363   VLTISHQFLVLDPQHEFKILLRLDFLIHDLMIPPNKYFVICRRSFYLLTN   412
MIT_Spar_c218_186   363   VLTISHQFLVLDPQHDFKILLRLDFLIHDLMIPPNKYFVISRRSFYLLTN   412
MIT_Suva_c957_346   362   VLTISHQFLILDPQNDFKALLRLDFLIHDLIIPPNKYFVISRRSLYLLTN   411
WashU_Sbay_Contig669.13   362   VLTISHQFLILDPQNDFKALLRLDFLIHDLIIPPNKYFVISRRSLYLLTN   411
WashU_Scas_Contig670.26   393   ILTISHQFLIVDTKTQFEIILKIDLLVHDLLIPPDKHFAFNNNRIFLLTL   442
WashU_Sklu_Contig2306.5   352   ILTNSNELIVLTASEKLEPIAKVDLLSHDILTPSERHFACFERQIFLLTS   401
WashU_Smik_Contig2700.2   265   VLTISHQFLVLDPQHEFKILLRLDFLIHDLMIPPNKYFVICRRSFYLLTN   314
Symbols






:** *:::::: .. .:: : ::*:* **:: *.:::*. .. ::***



SGD_Scer_VPS8/YAL002W   413   YSFKIGKFVSWSDITLRHILKGDYLGALEFIESLLQPYCPLANLLKLDNN   462
MIT_Smik_c1032_301   413   YAFKIGKFVSWSDITLRHILKGDYLGALEFIESLLQPYCPLSNLLKLYDD   462
MIT_Spar_c218_186   413   YSFKIGKFVSWSDITLRHILKGNYLGALEFIESLLQPYCPLANLLKLYNN   462
MIT_Suva_c957_346   412   YSFKIGKFVSWSDITLRRILKGDYLGALEFIESLLQPYCPLASLLKLYDS   461
WashU_Sbay_Contig669.13   412   YSFKIGKFVSWSDITLRRILKGDYLGALEFIESLLQPYCPLASLLKLYDS   461
WashU_Scas_Contig670.26   443   YGFKIGSFVTWSDITLSNVQKGDYMKALSYIELFLRPNFAIPTLLRLEPD   492
WashU_Sklu_Contig2306.5   402   YTLKLGKFLSWSDVILHYVQNGNYIPALETVGFLLSSGSSLAQFVNLEVD   451
WashU_Smik_Contig2700.2   315   YAFKIGKFVSWSDITLRHILKGDYLGALEFIESLLQPYCPLSNLLKLYDD   364
Symbols






* :*:*.*::***: * : :*:*: **. : :* . .:. ::.* .



SGD_Scer_VPS8/YAL002W   463   TEERTKQLMEPFYNLSLAALRFLIKKDNADYNRVYQLLMVVVRVLQQSSK   512
MIT_Smik_c1032_301   463   KEERAKQLMEPFYNLSLAALRFLIKKDSADYDRVYQLLMVVVRVFQRFSK   512
MIT_Spar_c218_186   463   TEERSKQLMEPFYNLSLAALRFLIKKDNADYGRVYQLLMVVVRVFQRFSK   512
MIT_Suva_c957_346   462   PEERSKQLMEPFYNLSLAALRFLIKKDSADYDRVYQLLMVVVRVFQRFPI   511
WashU_Sbay_Contig669.13   462   PEERSKQLMEPFYNLSLAALRFLIKKDSADYDRVYQLLMVVVRVFQRFPI   511
WashU_Scas_Contig670.26   493   QKEKETQLLEPFYNLALATQRFLLKKRDANYDNIFKLVSLVVRVLDSFHL   542
WashU_Sklu_Contig2306.5   452   LGKRKKQLEQPFRNLSLASLKYLLNKKECGYEKLFNLFSLILEVDNLFCD   501
WashU_Smik_Contig2700.2   365   KEERAKQLMEPFYNLSLAALRFLIKKDSADYDRVYQLLMVVVRVFQRFSK   414
Symbols






:: .** :** **:**: ::*::* ...* .:::*. :::.* :



SGD_Scer_VPS8/YAL002W   513   KLDS---IPSLDVFLEQGLEFFELKDNAVYFEVVANIVAQGSVTSISPVL   559
MIT_Smik_c1032_301   513   NLGT---LPPLEVFLEQGLEFFESKDNAVYFEVVANIVAQGSVTSISPVL   559
MIT_Spar_c218_186   513   KLDS---IPSLDVFLEQGLEFFELKDNAVYFEVVANIVAQGSVMSITPVL   559
MIT_Suva_c957_346   512   KLDT---IPSLEVFLEQALEFFESKDTAVYFEVVANIIAQGSVTSVSPVL   558
WashU_Sbay_Contig669.13   512   KLDT---IPSLEVFLEQALEFFESKDTAVYFEVVANIIAQGSVTSVSPVL   558
WashU_Scas_Contig670.26   543   KDTTSTLKISLNSFLEQALEFFDSNTIGLYYEVLSNLIIEGYIRSVSAPI   592
WashU_Sklu_Contig2306.5   502   SLEEQ-----VNFILDEPLELFNEEQLHVFYDVLSNKILEGAIKSLPPSV   546
WashU_Smik_Contig2700.2   415   NSGT---LPPLEVFLEQGLEFFESKDNAVYFEVVANIVAQGSVTSISPVL   461
Symbols






. :: :*:: **:*: : ::::*::* : :* : *:.. :



SGD_Scer_VPS8/YAL002W   560   FRSIIDYYAKEENLKVIEDLIIMLNPTTLDVDLAVKLCQKYNLFDLLIYI   609
MIT_Smik_c1032_301   560   FKSIIDYYAKEEDLKVIEDLIIMLDPITLDVDLAVKLCQHYNLSDLLIYI   609
MIT_Spar_c218_186   560   FRSIIDYYAKEENLKVIEDLIIMLDPATLDVDLAVKLCQNYNLFDLLIYI   609
MIT_Suva_c957_346   559   FKSIIDYYAKEENLKVIEDLIIMLDPVTLDVDLAVKLCQHYDLFDLLIYI   608
WashU_Sbay_Contig669.13   559   FKSIIDYYAKEENLKVIEDLIIMLDPVTLDVDLAVKLCQHYDLFDLLIYI   608
WashU_Scas_Contig670.26   593   FKNLISYFSSIKRFSTIQELIIILDSKTLDIDLAVKLCKEFHLSTILIYL   642
WashU_Sklu_Contig2306.5   547   LKKIITYYAEKEEYTLLEDLIVMLDPQFLDLDLAVKLCKEFKLYEVLIYL   596
WashU_Smik_Contig2700.2   462   FKSIIDYYAKEEDLKVIEDLIIMLDPITLDVDLAVKLCQHYNLSDLLIYI   511
Symbols






::.:* *::. : . :::**::*:. **:*******:.:.* :***:



SGD_Scer_VPS8/YAL002W   610   WNKIFDDYQTPVVDLIYRISNQSEKCVIFNGPQVPPETT-IFDYVTYILT   658
MIT_Smik_c1032_301   610   WNKVFDDYQTPLVDLIYRISNQSEKCIIFNGPQAPSETT-IFDYLTYILT   658
MIT_Spar_c218_186   610   WNKIFDDYQTPLVDLIYRISNQSEKCVIFNGPQAPPETT-IFDYLTYILT   658
MIT_Suva_c957_346   609   WNKIFDDYRTPLVDLIYRISNQNEKCIIFNGPQAPPETA-VFDYLTYILT   657
WashU_Sbay_Contig669.13   609   WNKIFDDYRTPLVDLIYRISNQNEKCIIFNGPQAPPETA-VFDYLTYILT   657
WashU_Scas_Contig670.26   643   WNKVFLDYISPLVDYLHLLAGDSNQCMLFDYTTKKIEYENIFTYLSFILL   692
WashU_Sklu_Contig2306.5   597   WNKVFTDYMTPLIDFIYRIKGETYKCLLFNDMPDKSVGK-VFDYLSFVLT   645
WashU_Smik_Contig2700.2   512   WNKVFDDYQTPLVDLIYRISNQSEKCIIFNGPQAPSETT-IFDYLTYILT   560
Symbols






***:* ** :*::* :: : .:. :*::*: :* *::::*



SGD_Scer_VPS8/YAL002W   659   GRQYPQNLSISPSDKCSKIQRELSAFIFSGFSIKWPSNSNHKLYICENPE   708
MIT_Smik_c1032_301   659   GRQYPQNLPLSPSSKCIEVQRELSAFIFSGYSIKWPMNSDHKLYICDDPE   708
MIT_Spar_c218_186   659   GRQYPQNLSISPSSKCIEIQRELSAFIFSGFSIKWPFNSDHKLYICENPE   708
MIT_Suva_c957_346   658   GRQYPQNLFISPSTKCIRVQRDLSTFIFSGYSIEWPLNSGQKLYICKNPE   707
WashU_Sbay_Contig669.13   658   GRQYPQNLFISPSTKCIRVQRDLSTFIFSGYSIEWPLNSGQKLYICKNPE   707
WashU_Scas_Contig670.26   693   GKQYPENIPIMPQELQDKIKMDIYGVLLNGTLIEWPKGSGEKVHTVKNSQ   742
WashU_Sklu_Contig2306.5   646   GRQYPTDTLVSPPATLLKAKLNLFYVIFSGASIEWPENSLSKLYTCDDYS   695
WashU_Smik_Contig2700.2   561   GRQYPQNLPLSPSSKCIEVQRELSAFIFSGYSIKWPMNSDHKLYICDDPE   610
Symbols






*:*** : : * . : :: .::.* *:** .* *:: .: .



SGD_Scer_VPS8/YAL002W   709   EEPAFPYFHLLLKSNPSRFLAMLNEVFEASLFNDDN----DMVASV-GEA   753
MIT_Smik_c1032_301   709   EELAFPYFNLLLKSNPNRFLAMLNEVFEASLFNDDN----DMVTLN-GEP   753
MIT_Spar_c218_186   709   EEPAFPYFHLLLKSNPSRFLAMLNEVFEASLFNDDN----DMVTSA-EGP   753
MIT_Suva_c957_346   708   EEPAFPYFNLLLSFNPNRFLSMLNEVFEASLFNDDN----DMMKPT-EET   752
WashU_Sbay_Contig669.13   708   EEPAFPYFNLLLSFNPNRFLSMLNEVFEASLFNDDN----DMMKPT-EET   752
WashU_Scas_Contig670.26   743   DEPAFPYLHLLLNYDIKSLLSLFNKVFEDSLFNISS----EFEQDSNGRI   788
WashU_Sklu_Contig2306.5   696   NEPAFPYLNLLLKYDAAGFLSMLNEVFEDSFLNEENGSLNEKDLDMDTYS   745
WashU_Smik_Contig2700.2   611   EELAFPYFNLLLKSNPNRFLAMLNEVFEASLFNDDN----DMVTLN-GEP   655
Symbols






:* ****::***. : :*:::*:*** *::* .. :



SGD_Scer_VPS8/YAL002W   754   ELVSRQYVIDLLLDAMKDTGNSDNIRVLVAIFIATSISKYPQFIKVSNQA   803
MIT_Smik_c1032_301   754   ESISRQYIIDLLLDIMKSTEHCNDIRVLVAIFIATSVSKYPQFIKVSNQA   803
MIT_Spar_c218_186   754   ESISRQYVTDLLLDAMKTTEHSDNIRVLVAIFIATSISKYPQFIKVSNQA   803
MIT_Suva_c957_346   753   ESVSRQYIIDLLMDVIRTSEHSDDVRVLVAIFIATSISKYPQFIKLSNQA   802
WashU_Sbay_Contig669.13   753   ESVSRQYIIDLLMDVIRTSEHSDDVRVLVAIFIATSISKYPQFIKLSNQA   802
WashU_Scas_Contig670.26   789   IRLDRQYIIDLLLDILKDLSD-DRKKSQLAVFVALNVAKFPQFISLSNNL   837
WashU_Sklu_Contig2306.5   746   MKINRQYIVDILLDAMKSNRDSRQNG-LIAIFITRNIPKYPQFIKLSGHT   794
WashU_Smik_Contig2700.2   656   ESISRQYIIDLLLDIMKSTEHCNDIRVLVAIFIATSVSKYPQFIKVSNQA   705
Symbols






:.***: *:*:* :: . :*:*:: .:.*:****.:*.:



SGD_Scer_VPS8/YAL002W   804   LDCVVNTICSSRVQGIYEISQIALESLLPYYHSRTTENFILELKEKNFNK   853
MIT_Smik_c1032_301   804   LDCVVCTICSSKVEGIYDISQIALESLLPYYHSKTTENFILELKEKKFNK   853
MIT_Spar_c218_186   804   LDCVVSTICSSRVEGIYEISQLALEALLPYYHSKTAENFILELREKKFNK   853
MIT_Suva_c957_346   803   LDCVVNTICSSKSEGTFEISQLALESLLPYYHSKTTENFILELKERKFNK   852
WashU_Sbay_Contig669.13   803   LDCVVNTICSSKSEGTFEISQLALESLLPYYHSKTTENFILELKERKFNK   852
WashU_Scas_Contig670.26   838   LEEVISNILLCHDNSSSEMSQIAIEAVIPIYAPKDPELFILEMKERNFNG   887
WashU_Sklu_Contig2306.5   795   IDGLVSVICNCNDSSLRNDAQRSLESLFTYYRPMKPDHLLTFVKECGFDR   844
WashU_Smik_Contig2700.2   706   LDCVVCTICSSKVEGIYDISQIALESLLPYYHSKTTENFILELKEKKFNK   755
Symbols






:: :: * .. .. : :* ::*:::. * . .: :: ::* *:



SGD_Scer_VPS8/YAL002W   854   VLFHIYKSENKYASALSLILETKDIEKEYNTDIVSITDYILKKCPPGSLE   903
MIT_Smik_c1032_301   854   VLFHIYKNENKYSNALSLLLETKNVEKEYNTDIVSLTEYILKNCPPGSLE   903
MIT_Spar_c218_186   854   VLFHIYKSENKYSNALSLLLETKDVEKEYNTDIVSITEYILKKCPSGSQE   903
MIT_Suva_c957_346   853   VLFHLYKSENKYSNALSLLLETDDVEKEYNTDILSITEYILKKCPPASSE   902
WashU_Sbay_Contig669.13   853   VLFHLYKSENKYSNALSLLLETDDVEKEYNTDILSITEYILKKCPPASSE   902
WashU_Scas_Contig670.26   888   VLFSFYRHSKRYFEWATLSLDSESTIETYGTPLIDVLKLIIAKTNPNSLE   937
WashU_Sklu_Contig2306.5   845   VLFSLYRKTQQYSKFLELRIRSDELSKSCPLSSLEAVELSLRDTASQPLE   894
WashU_Smik_Contig2700.2   756   VLFHIYKNENKYSNALSLLLETKNVEKEYNTDIVSLTEYILKNCPPGSLE   805
Symbols






*** :*: ::* . * : :.. : :. . : . . . *



SGD_Scer_VPS8/YAL002W   904   CGKVTEVIETNFDLLLSRIGIEKCVTIFSDFDYNLHQEILEVKNEETQQK   953
MIT_Smik_c1032_301   904   CSKVTEIIEMNFELLLSKIGIQKCVIIFSNFDISLHQEILKVKNEEIQQK   953
MIT_Spar_c218_186   904   CSKVIEVIEKNFELLLLRIGIEKCVTIFSNFDYSLHQEILKVKTEETQQK   953
MIT_Suva_c957_346   903   YSKVVGVIENNFELLLSRVGIEKCVMMFSDFDFSLHQEILKVETEETQQR   952
WashU_Sbay_Contig669.13   903   YSKVVGVIENNFELLLSRVGIEKCVMMFSDFDFSLHQEILKVETEETQQR   952
WashU_Scas_Contig670.26   938   HSKLVELFTTKMELILSTLGTTASVKLFHQLDSSLHKKVLLIPSLRLQQK   987
WashU_Sklu_Contig2306.5   895   RKLVIGVIENNFERLIENH-VQECVHLFNTFAPDLHKSILDIDNEYLQKQ   943
WashU_Smik_Contig2700.2   806   CSKVTEIIEMNFELLLSKIGIQKCVIIFSNFDNSLHQEILKVKNEEISAE   855
Symbols






: :: ::: :: .* :* : .**:.:* : . . .



SGD_Scer_VPS8/YAL002W   954   YLDKLFSTPNINNKVDKRLRNLHIELNCKYKSKREMILWLNGTVLSNAES   1003
MIT_Smik_c1032_301   954   YLDSLFSLSNVSNKVDKRLRTLYIELSSKYKNKREMILWLNRTDLSNAES   1003
MIT_Spar_c218_186   954   YLDKLFSIPNVNNKVDKRLRNLYIELNSKLKSKREMILWLNSTDLSNAES   1003
MIT_Suva_c957_346   953   YLDQLFSTSSISNKIDKRLRSLYIELNCKYKGKKEVISWLSRLDLNNAES   1002
WashU_Sbay_Contig669.13   953   YLDQLFSTSSISNKIDKRLRSLYIELNCKYKGKKEVISWLSRLDLNNAES   1002
WashU_Scas_Contig670.26   988   YLEDLFSFYPAYGTTDSIIKEKYIELSCTLKDNQDLIPWIESFDLTNIDV   1037
WashU_Sklu_Contig2306.5   944   YLDELIRLEGTCRAINKEMGYLYVELLCKQNDQLTLNHCLQKIDINNLDI   993
WashU_Smik_Contig2700.2   856   IPR-----------------------------------------------   858
Symbols










SGD_Scer_VPS8/YAL002W   1004   LQILDLLNQDSNFEAAAIIHERLESFNLAVRDLLSFIEQCLNEGKTNIST   1053
MIT_Smik_c1032_301   1004   LRVLDLLNQDLNFEAAAVIHERLQNYNLAVRDLLNSIEQFLNEGETNMNT   1053
MIT_Spar_c218_186   1004   LHVLDLLNQDSNLEAAAIIHERLENFNLAVRDLLSFIEQCLNEGETNITT   1053
MIT_Suva_c957_346   1003   LHILDLITQNSNFEAAAVIHERLQEFNLAVKDLLQSIEQCFNEGETNINV   1052
WashU_Sbay_Contig669.13   1003   LHILDLITQNSNFEAAAVIHERLQEFNLAVKDLLQSIEQCFNEGETNINV   1052
WashU_Scas_Contig670.26   1038   GKMNVLLSSSDNYEALAVLHFKLRDYSKTVDDLLKCINSEFLGKKSSQQV   1087
WashU_Sklu_Contig2306.5   994   QRISMSLKNHENFEGNIIIFTRLRKFSLAMNEVVKALGISLNESYDS-NK   1042
WashU_Smik_Contig2700.2   
   --------------------------------------------------   
Symbols










SGD_Scer_VPS8/YAL002W   1054   LLESLRRAFDDCNSAGTEKKSCWILLITFLITLYGKYPSHDE-RKDLCNK   1102
MIT_Smik_c1032_301   1054   FLDCLRRAFDDCNSAGTGKKSCWVFLITFLITLYGHYPSHNE-KKGLCNK   1102
MIT_Spar_c218_186   1054   LLDCLRRAFDDCNSAGAEKKSCWILLITFLITLYGKYPAHNE-RKDLCNK   1102
MIT_Suva_c957_346   1053   LSDYLRKAMDDCNSAAAEKKSCWIFLITFLITLYGNYSTHED-KKDLCNE   1101
WashU_Sbay_Contig669.13   1053   LSDYLRKAMDDCNSAAAEKKSCWIFLITFLITLYGNYSTHED-KKDLCNE   1101
WashU_Scas_Contig670.26   1088   VQRHLEYAIHTCVLSGDEEAANWTKLITSLIVIYENANIADH-EKEICNI   1136
WashU_Sklu_Contig2306.5   1043   IDKYVQLGIEICYNIKLDKEQLHECCIKFLVSLIANYGKLEQPVKNTCNL   1092
WashU_Smik_Contig2700.2   
   --------------------------------------------------   
Symbols










SGD_Scer_VPS8/YAL002W   1103   LLQEAFLGLVRSKSSSQKDSGGEFWEIMSSVLEHQDVILMKVQDLKQLLL   1152
MIT_Smik_c1032_301   1103   LLQEAFLGLVRSKSSSQKDWCGEFWEIMSSVLEHQDVILMRVQDLKQLLL   1152
MIT_Spar_c218_186   1103   LLEEAFLGLVRSKSSSQKDSGGEFWEIMSSVLEHQDVILMKVQDLKQLLM   1152
MIT_Suva_c957_346   1102   LLQEAFLGLVRSKSSSQKDAGGEFWEIMSSVLEHQDVILMKVQDLKQLLL   1151
WashU_Sbay_Contig669.13   1102   LLQEAFLGLVRSKSSSQKDAGGEFWEIMSSVLEHQDVILMKVQDLKQLLL   1151
WashU_Scas_Contig670.26   1137   LLQEVFIRLSATKQSSAAAGSNFFWMILGKVLEDPNVILLKTQHLKKLLG   1186
WashU_Sklu_Contig2306.5   1093   ALQKVFVKLADLNFQQDTENGEPFWDILTDVLENQELILMKLHDMRTLLQ   1142
WashU_Smik_Contig2700.2   
   --------------------------------------------------   
Symbols










SGD_Scer_VPS8/YAL002W   1153   NVFNTYKLERSLSELIQKIIEDSSQDLVQQYRKFLSEGWSIHTDDCEICG   1202
MIT_Smik_c1032_301   1153   NVFTTYKLERSLSGLIQKIIEDSSQDLVQLYRKFLSEGWSIHTEDCEVCG   1202
MIT_Spar_c218_186   1153   NVFNTYKLERSLSELIQKVIEDSSQDLVQQYRKFLSEGWSIHTDDCEVCG   1202
MIT_Suva_c957_346   1152   SVFTTYKLERSLSELLQKIIEDSSQDLVQLYRKFLNEGWSIHNDDCEVCG   1201
WashU_Sbay_Contig669.13   1152   SVFTTYKLERSLSELLQKIIEDSSQDLVQLYRKFLNEGWSIHNDDCEVCG   1201
WashU_Scas_Contig670.26   1187   DIFSAYDIEKCMADLILNILEKASLSVVHAYSDLLKEGWSIRNDECDVCG   1236
WashU_Sklu_Contig2306.5   1143   DIFTAYSIEECIKRLILKMVNDSSSEILENYKNKLSNGWSIHNHECEVCG   1192
WashU_Smik_Contig2700.2   
   --------------------------------------------------   
Symbols










SGD_Scer_VPS8/YAL002W   1203   KKIWGAGLDPLLFLAWENVQRHQDMISVDLKTP-LVIFKCHHGFHQTCLE   1251
MIT_Smik_c1032_301   1203   KKIWGAGLDPLLFLVWENVQRNQDMISVDLKTP-LVIFKCHHGFHQTCLE   1251
MIT_Spar_c218_186   1203   KKIWGAGLDPLLFLVWENVQRHQDMISVDLKTP-LVIFKCHHGFHQTCLE   1251
MIT_Suva_c957_346   1202   KKIWGAGLDPLLFLVWKNVQRHQDMISLDLETP-LVIFKCHHGFHQTCLE   1250
WashU_Sbay_Contig669.13   1202   KKIWGAGLDPLLFLVWKNVQRHQDMISLDLETP-LVIFKCHHGFHQTCLE   1250
WashU_Scas_Contig670.26   1237   KKIWGVEISDLTSVFWEELRRKETIYTIGAENYRIAVFKCHHGYHTKCLE   1286
WashU_Sklu_Contig2306.5   1193   KKIWGVGLDSRVFSLWESKQRQDPNENIFVQDCGLVVFKCHHGFHQMCLT   1242
WashU_Smik_Contig2700.2   
   --------------------------------------------------   
Symbols










SGD_Scer_VPS8/YAL002W   1252   NLAQKPDEYSCLICQTESNPKIV   1274
MIT_Smik_c1032_301   1252   NLAQRPNEYFCLICQTESNPK--   1272
MIT_Spar_c218_186   1252   NLAQKPNEYSCLICQTESNPD--   1272
MIT_Suva_c957_346   1251   NLAQKPNKYTCLICETKSSPK--   1271
WashU_Sbay_Contig669.13   1251   NLAQKPNKYTCLICETKSSPK--   1271
WashU_Scas_Contig670.26   1287   NMGQSNTTYKCLMCQRLDV----   1305
WashU_Sklu_Contig2306.5   1243   NLGQTERYYACLICMDDQH----   1261
WashU_Smik_Contig2700.2   
   -----------------------   
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_VPS8/YAL002W:

SGD_Scer_VPS8/YAL002W  Length: 1275  Mon Nov  7 14:39:01 2016  Type: P  Check: 7814  ..

       1  MEQNGLDHDS RSSIDTTIND TQKTFLEFRS YTQLSEKLAS SSSYTAPPLN

      51  EDGPKGVASA VSQGSESVVS WTTLTHVYSI LGAYGGPTCL YPTATYFLMG

     101  TSKGCVLIFN YNEHLQTILV PTLSEDPSIH SIRSPVKSIV ICSDGTHVAA

     151  SYETGNICIW NLNVGYRVKP TSEPTNGMTP TPALPAVLHI DDHVNKEITG

     201  LDFFGARHTA LIVSDRTGKV SLYNGYRRGF WQLVYNSKKI LDVNSSKEKL

     251  IRSKLSPLIS REKISTNLLS VLTTTHFALI LLSPHVSLMF QETVEPSVQN

     301  SLVVNSSISW TQNCSRVAYS VNNKISVISI SSSDFNVQSA SHSPEFAESI

     351  LSIQWIDQLL LGVLTISHQF LVLHPQHDFK ILLRLDFLIH DLMIPPNKYF

     401  VISRRSFYLL TNYSFKIGKF VSWSDITLRH ILKGDYLGAL EFIESLLQPY

     451  CPLANLLKLD NNTEERTKQL MEPFYNLSLA ALRFLIKKDN ADYNRVYQLL

     501  MVVVRVLQQS SKKLDSIPSL DVFLEQGLEF FELKDNAVYF EVVANIVAQG

     551  SVTSISPVLF RSIIDYYAKE ENLKVIEDLI IMLNPTTLDV DLAVKLCQKY

     601  NLFDLLIYIW NKIFDDYQTP VVDLIYRISN QSEKCVIFNG PQVPPETTIF

     651  DYVTYILTGR QYPQNLSISP SDKCSKIQRE LSAFIFSGFS IKWPSNSNHK

     701  LYICENPEEE PAFPYFHLLL KSNPSRFLAM LNEVFEASLF NDDNDMVASV

     751  GEAELVSRQY VIDLLLDAMK DTGNSDNIRV LVAIFIATSI SKYPQFIKVS

     801  NQALDCVVNT ICSSRVQGIY EISQIALESL LPYYHSRTTE NFILELKEKN

     851  FNKVLFHIYK SENKYASALS LILETKDIEK EYNTDIVSIT DYILKKCPPG

     901  SLECGKVTEV IETNFDLLLS RIGIEKCVTI FSDFDYNLHQ EILEVKNEET

     951  QQKYLDKLFS TPNINNKVDK RLRNLHIELN CKYKSKREMI LWLNGTVLSN

    1001  AESLQILDLL NQDSNFEAAA IIHERLESFN LAVRDLLSFI EQCLNEGKTN

    1051  ISTLLESLRR AFDDCNSAGT EKKSCWILLI TFLITLYGKY PSHDERKDLC

    1101  NKLLQEAFLG LVRSKSSSQK DSGGEFWEIM SSVLEHQDVI LMKVQDLKQL

    1151  LLNVFNTYKL ERSLSELIQK IIEDSSQDLV QQYRKFLSEG WSIHTDDCEI

    1201  CGKKIWGAGL DPLLFLAWEN VQRHQDMISV DLKTPLVIFK CHHGFHQTCL

    1251  ENLAQKPDEY SCLICQTESN PKIV*

Protein Sequence for MIT_Smik_c1032_301:

MIT_Smik_c1032_301  Length: 1273  Mon Nov  7 14:39:01 2016  Type: P  Check: 6018  ..

       1  MEQNGLDHDS RSSIDTANND TQKTFLEFRS YTQLSEKLAS NPSYATSRPN

      51  DDSSKGVATA VSQGSGSIIS WTTLTHVYSI LGAYGGPTCL YPTTTYFLMG

     101  TSKGYVLIFN YNEHLQTILV PTLFEDPSAH PIRSSVKSIV ICSDGTHVAA

     151  SYESGNICLW NLNVGYRVKT ASEPTNGMSP TPALPAILHI DDHLNKEVTG

     201  LDFFGARHTA LIVSDRTGKV SLYNGYRRGF WQLVYNSKKI LNVNSFNEKL

     251  IRSKLSPLIS QEKISTNLLS VLTTTHFALI SLSPHVSLIF QETIEPSIRN

     301  SLVVNSSISW TQNCSMVAYS VNNKISIISL SLSDLNVQSA THSSEFAESI

     351  LSIQWIDQLL LGVLTISHQF LVLDPQHEFK ILLRLDFLIH DLMIPPNKYF

     401  VICRRSFYLL TNYAFKIGKF VSWSDITLRH ILKGDYLGAL EFIESLLQPY

     451  CPLSNLLKLY DDKEERAKQL MEPFYNLSLA ALRFLIKKDS ADYDRVYQLL

     501  MVVVRVFQRF SKNLGTLPPL EVFLEQGLEF FESKDNAVYF EVVANIVAQG

     551  SVTSISPVLF KSIIDYYAKE EDLKVIEDLI IMLDPITLDV DLAVKLCQHY

     601  NLSDLLIYIW NKVFDDYQTP LVDLIYRISN QSEKCIIFNG PQAPSETTIF

     651  DYLTYILTGR QYPQNLPLSP SSKCIEVQRE LSAFIFSGYS IKWPMNSDHK

     701  LYICDDPEEE LAFPYFNLLL KSNPNRFLAM LNEVFEASLF NDDNDMVTLN

     751  GEPESISRQY IIDLLLDIMK STEHCNDIRV LVAIFIATSV SKYPQFIKVS

     801  NQALDCVVCT ICSSKVEGIY DISQIALESL LPYYHSKTTE NFILELKEKK

     851  FNKVLFHIYK NENKYSNALS LLLETKNVEK EYNTDIVSLT EYILKNCPPG

     901  SLECSKVTEI IEMNFELLLS KIGIQKCVII FSNFDISLHQ EILKVKNEEI

     951  QQKYLDSLFS LSNVSNKVDK RLRTLYIELS SKYKNKREMI LWLNRTDLSN

    1001  AESLRVLDLL NQDLNFEAAA VIHERLQNYN LAVRDLLNSI EQFLNEGETN

    1051  MNTFLDCLRR AFDDCNSAGT GKKSCWVFLI TFLITLYGHY PSHNEKKGLC

    1101  NKLLQEAFLG LVRSKSSSQK DWCGEFWEIM SSVLEHQDVI LMRVQDLKQL

    1151  LLNVFTTYKL ERSLSGLIQK IIEDSSQDLV QLYRKFLSEG WSIHTEDCEV

    1201  CGKKIWGAGL DPLLFLVWEN VQRNQDMISV DLKTPLVIFK CHHGFHQTCL

    1251  ENLAQRPNEY FCLICQTESN PK*

Protein Sequence for MIT_Spar_c218_186:

MIT_Spar_c218_186  Length: 1273  Mon Nov  7 14:39:01 2016  Type: P  Check: 9988  ..

       1  MEQNGLDHDS RSSIDTTIND TQKTFLEFRS YTQLSEKLAS NPFYATPHPD

      51  DDSLKGVASA VSQGSESVVS WTTLTHVYSI LGAYGGPTCL YPTATYFLMG

     101  TSKGCVLIFN YNEHLQTILV PTLSEDPSAH SIRSPVKSIV ICSDGTHVAA

     151  SYENGSICIW NLNVGYRVKP VSEPTNSMTP TPALPAVLHI DDHLNKEITG

     201  LDFFGARHTA LIVSDRTGRV SLYNGYRRGF WQLVYNSKKI LDVNSFDEKL

     251  IRSKLSPLIS REKISTNLLS VLTTTHFALI SLSPHVSLIF QETIEPSVQN

     301  SLVVNSSISW TQNCSRVAYS VNNKISIISM SSSDLNVQSA KHSPEFAESI

     351  LSIQWIDQLL LGVLTISHQF LVLDPQHDFK ILLRLDFLIH DLMIPPNKYF

     401  VISRRSFYLL TNYSFKIGKF VSWSDITLRH ILKGNYLGAL EFIESLLQPY

     451  CPLANLLKLY NNTEERSKQL MEPFYNLSLA ALRFLIKKDN ADYGRVYQLL

     501  MVVVRVFQRF SKKLDSIPSL DVFLEQGLEF FELKDNAVYF EVVANIVAQG

     551  SVMSITPVLF RSIIDYYAKE ENLKVIEDLI IMLDPATLDV DLAVKLCQNY

     601  NLFDLLIYIW NKIFDDYQTP LVDLIYRISN QSEKCVIFNG PQAPPETTIF

     651  DYLTYILTGR QYPQNLSISP SSKCIEIQRE LSAFIFSGFS IKWPFNSDHK

     701  LYICENPEEE PAFPYFHLLL KSNPSRFLAM LNEVFEASLF NDDNDMVTSA

     751  EGPESISRQY VTDLLLDAMK TTEHSDNIRV LVAIFIATSI SKYPQFIKVS

     801  NQALDCVVST ICSSRVEGIY EISQLALEAL LPYYHSKTAE NFILELREKK

     851  FNKVLFHIYK SENKYSNALS LLLETKDVEK EYNTDIVSIT EYILKKCPSG

     901  SQECSKVIEV IEKNFELLLL RIGIEKCVTI FSNFDYSLHQ EILKVKTEET

     951  QQKYLDKLFS IPNVNNKVDK RLRNLYIELN SKLKSKREMI LWLNSTDLSN

    1001  AESLHVLDLL NQDSNLEAAA IIHERLENFN LAVRDLLSFI EQCLNEGETN

    1051  ITTLLDCLRR AFDDCNSAGA EKKSCWILLI TFLITLYGKY PAHNERKDLC

    1101  NKLLEEAFLG LVRSKSSSQK DSGGEFWEIM SSVLEHQDVI LMKVQDLKQL

    1151  LMNVFNTYKL ERSLSELIQK VIEDSSQDLV QQYRKFLSEG WSIHTDDCEV

    1201  CGKKIWGAGL DPLLFLVWEN VQRHQDMISV DLKTPLVIFK CHHGFHQTCL

    1251  ENLAQKPNEY SCLICQTESN PD*

Protein Sequence for MIT_Suva_c957_346:

MIT_Suva_c957_346  Length: 1272  Mon Nov  7 14:39:01 2016  Type: P  Check: 8429  ..

       1  MEQNGLDHDS RSSIDTINDT QKSFLEFRSY THLSEKLASN TAFPASQPEE

      51  DGPKGVATAI SQGSESVVSW TSLTHVYSIL GAYGGPTCLY PTTTYFLMGT

     101  SRGSVLIFNF NEHLQTILVP TLSEDPAAHS IRSPVKSIAV CSDGTHVAAS

     151  YESGSICVWN LNVGYRVKIV HEPTSGMTPT PSIPAILHID DHLNKEITGL

     201  DFFGTRHTAL IVSDRTGRIS LYNGYRRGFW QLVYNSSKIL DLNSPNERLI

     251  RSRLSPLITQ DKNSLNLLSV LTNTHFALLS LSPHVSLVCQ EPIESSIRHS

     301  LVMNSSISWT YNSSRVAYSV NNKISVISMS LSDLNIQSIK HSSEFPESIL

     351  SIQWIDQFLL GVLTISHQFL ILDPQNDFKA LLRLDFLIHD LIIPPNKYFV

     401  ISRRSLYLLT NYSFKIGKFV SWSDITLRRI LKGDYLGALE FIESLLQPYC

     451  PLASLLKLYD SPEERSKQLM EPFYNLSLAA LRFLIKKDSA DYDRVYQLLM

     501  VVVRVFQRFP IKLDTIPSLE VFLEQALEFF ESKDTAVYFE VVANIIAQGS

     551  VTSVSPVLFK SIIDYYAKEE NLKVIEDLII MLDPVTLDVD LAVKLCQHYD

     601  LFDLLIYIWN KIFDDYRTPL VDLIYRISNQ NEKCIIFNGP QAPPETAVFD

     651  YLTYILTGRQ YPQNLFISPS TKCIRVQRDL STFIFSGYSI EWPLNSGQKL

     701  YICKNPEEEP AFPYFNLLLS FNPNRFLSML NEVFEASLFN DDNDMMKPTE

     751  ETESVSRQYI IDLLMDVIRT SEHSDDVRVL VAIFIATSIS KYPQFIKLSN

     801  QALDCVVNTI CSSKSEGTFE ISQLALESLL PYYHSKTTEN FILELKERKF

     851  NKVLFHLYKS ENKYSNALSL LLETDDVEKE YNTDILSITE YILKKCPPAS

     901  SEYSKVVGVI ENNFELLLSR VGIEKCVMMF SDFDFSLHQE ILKVETEETQ

     951  QRYLDQLFST SSISNKIDKR LRSLYIELNC KYKGKKEVIS WLSRLDLNNA

    1001  ESLHILDLIT QNSNFEAAAV IHERLQEFNL AVKDLLQSIE QCFNEGETNI

    1051  NVLSDYLRKA MDDCNSAAAE KKSCWIFLIT FLITLYGNYS THEDKKDLCN

    1101  ELLQEAFLGL VRSKSSSQKD AGGEFWEIMS SVLEHQDVIL MKVQDLKQLL

    1151  LSVFTTYKLE RSLSELLQKI IEDSSQDLVQ LYRKFLNEGW SIHNDDCEVC

    1201  GKKIWGAGLD PLLFLVWKNV QRHQDMISLD LETPLVIFKC HHGFHQTCLE

    1251  NLAQKPNKYT CLICETKSSP K*

Protein Sequence for WashU_Sbay_Contig669.13:

WashU_Sbay_Contig669.13  Length: 1272  Mon Nov  7 14:39:01 2016  Type: P  Check: 8429  ..

       1  MEQNGLDHDS RSSIDTINDT QKSFLEFRSY THLSEKLASN TAFPASQPEE

      51  DGPKGVATAI SQGSESVVSW TSLTHVYSIL GAYGGPTCLY PTTTYFLMGT

     101  SRGSVLIFNF NEHLQTILVP TLSEDPAAHS IRSPVKSIAV CSDGTHVAAS

     151  YESGSICVWN LNVGYRVKIV HEPTSGMTPT PSIPAILHID DHLNKEITGL

     201  DFFGTRHTAL IVSDRTGRIS LYNGYRRGFW QLVYNSSKIL DLNSPNERLI

     251  RSRLSPLITQ DKNSLNLLSV LTNTHFALLS LSPHVSLVCQ EPIESSIRHS

     301  LVMNSSISWT YNSSRVAYSV NNKISVISMS LSDLNIQSIK HSSEFPESIL

     351  SIQWIDQFLL GVLTISHQFL ILDPQNDFKA LLRLDFLIHD LIIPPNKYFV

     401  ISRRSLYLLT NYSFKIGKFV SWSDITLRRI LKGDYLGALE FIESLLQPYC

     451  PLASLLKLYD SPEERSKQLM EPFYNLSLAA LRFLIKKDSA DYDRVYQLLM

     501  VVVRVFQRFP IKLDTIPSLE VFLEQALEFF ESKDTAVYFE VVANIIAQGS

     551  VTSVSPVLFK SIIDYYAKEE NLKVIEDLII MLDPVTLDVD LAVKLCQHYD

     601  LFDLLIYIWN KIFDDYRTPL VDLIYRISNQ NEKCIIFNGP QAPPETAVFD

     651  YLTYILTGRQ YPQNLFISPS TKCIRVQRDL STFIFSGYSI EWPLNSGQKL

     701  YICKNPEEEP AFPYFNLLLS FNPNRFLSML NEVFEASLFN DDNDMMKPTE

     751  ETESVSRQYI IDLLMDVIRT SEHSDDVRVL VAIFIATSIS KYPQFIKLSN

     801  QALDCVVNTI CSSKSEGTFE ISQLALESLL PYYHSKTTEN FILELKERKF

     851  NKVLFHLYKS ENKYSNALSL LLETDDVEKE YNTDILSITE YILKKCPPAS

     901  SEYSKVVGVI ENNFELLLSR VGIEKCVMMF SDFDFSLHQE ILKVETEETQ

     951  QRYLDQLFST SSISNKIDKR LRSLYIELNC KYKGKKEVIS WLSRLDLNNA

    1001  ESLHILDLIT QNSNFEAAAV IHERLQEFNL AVKDLLQSIE QCFNEGETNI

    1051  NVLSDYLRKA MDDCNSAAAE KKSCWIFLIT FLITLYGNYS THEDKKDLCN

    1101  ELLQEAFLGL VRSKSSSQKD AGGEFWEIMS SVLEHQDVIL MKVQDLKQLL

    1151  LSVFTTYKLE RSLSELLQKI IEDSSQDLVQ LYRKFLNEGW SIHNDDCEVC

    1201  GKKIWGAGLD PLLFLVWKNV QRHQDMISLD LETPLVIFKC HHGFHQTCLE

    1251  NLAQKPNKYT CLICETKSSP K*

Protein Sequence for WashU_Scas_Contig670.26:

WashU_Scas_Contig670.26  Length: 1306  Mon Nov  7 14:39:01 2016  Type: P  Check: 507  ..

       1  MVKYNVTIQY SNKLKHSSNG DMEDEAPLSG QNIETMSMGN NTVQLGSSST

      51  VDQLPFDDLQ TPSKSFNDSL ASTVPSISNS LFFKETAHSN SLIKWTTLNQ

     101  IYSLVSAYGG PTCILPTKSY FVLGTSKGAL LIFNFKEFLQ TILLPQISDK

     151  ETLLRSAVKT IAVATDGTYL AAAYQSGDVF IWNLNLKTTN EDIPFFENRN

     201  EPLSSVNSLD AILHITYHKD SDINGMGFLH NRHTALIVSD SSSRITFHNG

     251  FRNSFWNLTY SSKDILSLSP NEKLFCSMMA LPPRDSNFKS GNLLAILTNI

     301  NFVILSTSPH PEILFQENLH DAKSNTTEGP IYNSSIAWST DRSQIAYCIN

     351  KTVFLFGLSN QVTPLEFVIT RRTSTFTESI LSLQWLNPRL LGILTISHQF

     401  LIVDTKTQFE IILKIDLLVH DLLIPPDKHF AFNNNRIFLL TLYGFKIGSF

     451  VTWSDITLSN VQKGDYMKAL SYIELFLRPN FAIPTLLRLE PDQKEKETQL

     501  LEPFYNLALA TQRFLLKKRD ANYDNIFKLV SLVVRVLDSF HLKDTTSTLK

     551  ISLNSFLEQA LEFFDSNTIG LYYEVLSNLI IEGYIRSVSA PIFKNLISYF

     601  SSIKRFSTIQ ELIIILDSKT LDIDLAVKLC KEFHLSTILI YLWNKVFLDY

     651  ISPLVDYLHL LAGDSNQCML FDYTTKKIEY ENIFTYLSFI LLGKQYPENI

     701  PIMPQELQDK IKMDIYGVLL NGTLIEWPKG SGEKVHTVKN SQDEPAFPYL

     751  HLLLNYDIKS LLSLFNKVFE DSLFNISSEF EQDSNGRIIR LDRQYIIDLL

     801  LDILKDLSDD RKKSQLAVFV ALNVAKFPQF ISLSNNLLEE VISNILLCHD

     851  NSSSEMSQIA IEAVIPIYAP KDPELFILEM KERNFNGVLF SFYRHSKRYF

     901  EWATLSLDSE STIETYGTPL IDVLKLIIAK TNPNSLEHSK LVELFTTKME

     951  LILSTLGTTA SVKLFHQLDS SLHKKVLLIP SLRLQQKYLE DLFSFYPAYG

    1001  TTDSIIKEKY IELSCTLKDN QDLIPWIESF DLTNIDVGKM NVLLSSSDNY

    1051  EALAVLHFKL RDYSKTVDDL LKCINSEFLG KKSSQQVVQR HLEYAIHTCV

    1101  LSGDEEAANW TKLITSLIVI YENANIADHE KEICNILLQE VFIRLSATKQ

    1151  SSAAAGSNFF WMILGKVLED PNVILLKTQH LKKLLGDIFS AYDIEKCMAD

    1201  LILNILEKAS LSVVHAYSDL LKEGWSIRND ECDVCGKKIW GVEISDLTSV

    1251  FWEELRRKET IYTIGAENYR IAVFKCHHGY HTKCLENMGQ SNTTYKCLMC

    1301  QRLDV*

Protein Sequence for WashU_Sklu_Contig2306.5:

WashU_Sklu_Contig2306.5  Length: 1262  Mon Nov  7 14:39:01 2016  Type: P  Check: 4009  ..

       1  MSDESIHSVA TGLSCEPSFL EQRAQTRLTT RSRPNSNTSQ FPSSPVHQTF

      51  SACNPFDESS DNYITPVNWA SLQQVYPMLS IYGGATCIYP AQSYFALGTS

     101  RACILILNHK QILQTILGPQ DENFRSPVER ISVSSDGTHV AASYQSGDVF

     151  IWNLNGGESH ERQLLPILNI TTHKGCNING LGFVGERHTA MVISDDSGAV

     201  LYHTGFRNHL WQLTYRTKVI LNVANEGQIL QTAISPATEV SGNKILRELH

     251  LLATVSQDSF ALISMNPHLV TQYLEKAPKN DSGISSPFRA NISWGHSGTK

     301  VAYSLNKSIS VFVLTGEKVN EEKLVNISKR ETWNCQEEII NVQWVSEDLI

     351  GILTNSNELI VLTASEKLEP IAKVDLLSHD ILTPSERHFA CFERQIFLLT

     401  SYTLKLGKFL SWSDVILHYV QNGNYIPALE TVGFLLSSGS SLAQFVNLEV

     451  DLGKRKKQLE QPFRNLSLAS LKYLLNKKEC GYEKLFNLFS LILEVDNLFC

     501  DSLEEQVNFI LDEPLELFNE EQLHVFYDVL SNKILEGAIK SLPPSVLKKI

     551  ITYYAEKEEY TLLEDLIVML DPQFLDLDLA VKLCKEFKLY EVLIYLWNKV

     601  FTDYMTPLID FIYRIKGETY KCLLFNDMPD KSVGKVFDYL SFVLTGRQYP

     651  TDTLVSPPAT LLKAKLNLFY VIFSGASIEW PENSLSKLYT CDDYSNEPAF

     701  PYLNLLLKYD AAGFLSMLNE VFEDSFLNEE NGSLNEKDLD MDTYSMKINR

     751  QYIVDILLDA MKSNRDSRQN GLIAIFITRN IPKYPQFIKL SGHTIDGLVS

     801  VICNCNDSSL RNDAQRSLES LFTYYRPMKP DHLLTFVKEC GFDRVLFSLY

     851  RKTQQYSKFL ELRIRSDELS KSCPLSSLEA VELSLRDTAS QPLERKLVIG

     901  VIENNFERLI ENHVQECVHL FNTFAPDLHK SILDIDNEYL QKQYLDELIR

     951  LEGTCRAINK EMGYLYVELL CKQNDQLTLN HCLQKIDINN LDIQRISMSL

    1001  KNHENFEGNI IIFTRLRKFS LAMNEVVKAL GISLNESYDS NKIDKYVQLG

    1051  IEICYNIKLD KEQLHECCIK FLVSLIANYG KLEQPVKNTC NLALQKVFVK

    1101  LADLNFQQDT ENGEPFWDIL TDVLENQELI LMKLHDMRTL LQDIFTAYSI

    1151  EECIKRLILK MVNDSSSEIL ENYKNKLSNG WSIHNHECEV CGKKIWGVGL

    1201  DSRVFSLWES KQRQDPNENI FVQDCGLVVF KCHHGFHQMC LTNLGQTERY

    1251  YACLICMDDQ H*

Protein Sequence for WashU_Smik_Contig2700.2:

WashU_Smik_Contig2700.2  Length: 859  Mon Nov  7 14:39:01 2016  Type: P  Check: 1882  ..

       1  MGTSKGYVLI FNYNEHLQTI LVPTLFEDPS AHSIRSSVKS IVICSDGTHV

      51  AASYESGNIC LWNLNVGYRV KTASEPTNGM SPTPALPAIL HIDDHLNKEV

     101  TGLDFFGARH TALIVSDRTG KVSLYNGYRR GFWQLVYNSK KILNVNSFNE

     151  KLIRSKLSPL ISQEKISTNL LSVLTTTHFA LISLSPHVSL IFQETIEPSI

     201  RNSLVVNSSI SWTQNCSMVA YSVNNKISII SLSLSDLNVQ SATHSSEFAE

     251  SILSIQWIDQ LLLGVLTISH QFLVLDPQHE FKILLRLDFL IHDLMIPPNK

     301  YFVICRRSFY LLTNYAFKIG KFVSWSDITL RHILKGDYLG ALEFIESLLQ

     351  PYCPLSNLLK LYDDKEERAK QLMEPFYNLS LAALRFLIKK DSADYDRVYQ

     401  LLMVVVRVFQ RFSKNSGTLP PLEVFLEQGL EFFESKDNAV YFEVVANIVA

     451  QGSVTSISPV LFKSIIDYYA KEEDLKVIED LIIMLDPITL DVDLAVKLCQ

     501  HYNLSDLLIY IWNKVFDDYQ TPLVDLIYRI SNQSEKCIIF NGPQAPSETT

     551  IFDYLTYILT GRQYPQNLPL SPSSKCIEVQ RELSAFIFSG YSIKWPMNSD

     601  HKLYICDDPE EELAFPYFNL LLKSNPNRFL AMLNEVFEAS LFNDDNDMVT

     651  LNGEPESISR QYIIDLLLDI MKSTEHCNDI RVLVAIFIAT SVSKYPQFIK

     701  VSNQALDCVV CTICSSKVEG IYDISQIALE SLLPYYHSKT TENFILELKE

     751  KKFNKVLFHI YKNENKYSNA LSLLLETKNV EKEYNTDIVS LTEYILKNCP

     801  PGSLECSKVT EIIEMNFELL LSKIGIQKCV IIFSNFDNSL HQEILKVKNE

     851  EISAEIPR*