---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

ERI1/YPL096C-A Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXVI: 366732 to 366526 CDS: 366732 - 366526 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
ERI1	YPL096C-A	RIN1	ORF, Verified	S000028423
This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community. Gene name reserved on: 2002-03-22. Gene name expires on 2004-04-10.
Description
Endoplasmic reticulum membrane protein that binds to and inhibits GTP-bound Ras2p at the ER; component of the GPI-GnT complex which catalyzes the first step in GPI-anchor biosynthesis; probable homolog of mammalian PIG-Y protein

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By GTPase inhibitor activity Sobering AK, et al. (2003) A novel Ras inhibitor, Eri1, engages yeast Ras at the endoplasmic reticulum. Mol Cell Biol 23(14):4983-90      IPI : Inferred from Physical Interaction with SGD:RAS2 Assigned on 2005-11-22 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By GPI anchor biosynthetic process Sobering AK, et al. (2004) Yeast Ras regulates the complex that catalyzes the first step in GPI-anchor biosynthesis at the ER. Cell 117(5):637-48          IMP : Inferred from Mutant Phenotype Assigned on 2005-07-13 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0337 Assigned on 2007-05-23 UniProtKB Ras protein signal transduction Sobering AK, et al. (2003) A novel Ras inhibitor, Eri1, engages yeast Ras at the endoplasmic reticulum. Mol Cell Biol 23(14):4983-90      IMP : Inferred from Mutant Phenotype Assigned on 2005-11-22 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB endoplasmic reticulum membrane Sobering AK, et al. (2003) A novel Ras inhibitor, Eri1, engages yeast Ras at the endoplasmic reticulum. Mol Cell Biol 23(14):4983-90      IDA : Inferred from Direct Assay Assigned on 2005-07-12 SGD glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex Sobering AK, et al. (2004) Yeast Ras regulates the complex that catalyzes the first step in GPI-anchor biosynthesis at the ER. Cell 117(5):637-48          IPI : Inferred from Physical Interaction with SGD:GPI2 Assigned on 2005-07-13 SGD integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forERI1/YPL096C-A for ERI1 1) Sobering AK, et al. (2003) A novel Ras inhibitor, Eri1, engages yeast Ras at the endoplasmic reticulum. Mol Cell Biol 23(14):4983-90      2) Murakami Y, et al. (2005) The initial enzyme for glycosylphosphatidylinositol biosynthesis requires PIG-Y, a seventh component. Mol Biol Cell 16(11):5236-46

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ERI1/YPL096C-A

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ERI1/YPL096C-A

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MRPRDQG C-term FASSKDE Length(aa) 68 MW(Da) 8,039 pI 4.76 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.045   Codon Adaptation Index 0.092   Frequency of Optimal Codons 0.393   Hydropathicity of Protein 0.499   Aromaticity Score 0.191	10 20 30 40 50 | | | | | MRPRDQGFLVLGFTYSVLLISLATFYWLRNNDSFLHYWCVLLLCPATLWL WALIAWCDSEMFASSKDE*

Protein Structures from PDB: proteins of known structure with sequence similarity to ERI1/YPL096C-A, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Date Standardized	Reference
ERI1	2003-07-08	Sobering AK, et al. (2003) A novel Ras inhibitor, Eri1, engages yeast Ras at the endoplasmic reticulum. Mol Cell Biol 23(14):4983-90

Nomenclature History Notes

Date	Note
2008-12-16	Note that S. cerevisiae ERI1 is not orthologous to the gene named ERI1 or ERI-1 in S. pombe, C. elegans, and human.
2003-05-23	RIN1 was reserved by D.E. Levin for YPL096C-A. Subsequently the author changed the name to ERI1, since there is a mammalian protein with the same name RIN1. As a result, RIN1 was made an alias name for YPL096C-A.

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YPL096C-A	SGD Systematic Sequence
856008	NCBI: Gene ID
NP_690846.1	NCBI: RefSeq protein version ID
NP_690846.1	NCBI: RefSeq protein version ID
23270400	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
11 curated references; 0 references not yet curated
Reviews	Fujita M and Kinoshita T (2009) Structural remodeling of GPI anchors during biosynthesis and after attachment to proteins. FEBS Lett	|ARV1 |BST1 |CDC1 |CWH43 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |MORE
Regulation of Transcription	de Melo HF, et al. (2009) Physiological and molecular analysis of the stress response of Saccharomyces cerevisiae imposed by strong inorganic acid with implication to industrial fermentations. J Appl Microbiol	|AGP1 |ALD3 |APT2 |ARO9 |BMS1 |CAR2 |CBF5 |DDR2 |ERR1 |ERR3 |ESS1 |FMP16 |GCV1 |GCY1 |MORE
Reviews	Fujita M and Jigami Y (2008) Lipid remodeling of GPI-anchored proteins and its function. Biochim Biophys Acta 1780(3):410-20	|BST1 |CDC42 |CWH43 |EGT2 |EMP24 |ERV25 |FUR4 |GAS1 |GPI10 |GUP1 |GWT1 |IRE1 |LAS21 |MCD4 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Kajiwara K, et al. (2008) Yeast ARV1 Is Required for Efficient Delivery of an Early GPI Intermediate to the First Mannosyltransferase during GPI Assembly and Controls Lipid Flow from the Endoplasmic Reticulum. Mol Biol Cell 19(5):2069-82	|ARV1 |GAA1 |GAS1 |GPI15 |GPI2 |GWT1 |LAS21 |PMI40 |SPT14 |YPS1
Reviews	Bosson R and Conzelmann A (2007) Multiple functions of inositolphosphorylceramides in the formation and intracellular transport of glycosylphosphatidylinositol-anchored proteins in yeast. Biochem Soc Symp (74):199-209	|BST1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI17 |GPI18 |GPI19 |MORE
Reviews	Orlean P and Menon AK (2007) Thematic review series: lipid posttranslational modifications. GPI anchoring of protein in yeast and mammalian cells, or: how we learned to stop worrying and love glycophospholipids. J Lipid Res 48(5):993-1011	|BST1 |CWH43 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI17 |GPI18 |MORE
Reviews	Pittet M and Conzelmann A (2007) Biosynthesis and function of GPI proteins in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1771(3):405-20	|BST1 |CWH43 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI17 |GPI18 |MORE
Mutants/Phenotypes Strains/Constructs	Kastenmayer JP, et al. (2006) Functional genomics of genes with small open reading frames (sORFs) in S. cerevisiae. Genome Res 16(3):365-73	|COA2 |DAD3 |DAD4 |EFG1 |HSK3 |KSH1 |KTI11 |NOP10 |RRG10 |SOM1 |SUS1 |TFB5 |TSC3 |YBL071C-B |MORE
Non-Fungal Related Genes/Proteins	Murakami Y, et al. (2005) The initial enzyme for glycosylphosphatidylinositol biosynthesis requires PIG-Y, a seventh component. Mol Biol Cell 16(11):5236-46
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Regulation of Strains/Constructs	Sobering AK, et al. (2004) Yeast Ras regulates the complex that catalyzes the first step in GPI-anchor biosynthesis at the ER. Cell 117(5):637-48	|GFA1 |GPI1 |GPI2 |RAS2
Cellular Location Function/Process Protein Sequence Features Regulatory Role	Sobering AK, et al. (2003) A novel Ras inhibitor, Eri1, engages yeast Ras at the endoplasmic reticulum. Mol Cell Biol 23(14):4983-90

Return to SGD

Send a Message to the SGD Curators