---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

BUD25/YER014C-A Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrV: 184699 to 183730 intron: 184676 - 184169 CDS: 184699 - 184677, 184168 - 183730 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
BUD25	YER014C-A		ORF, Verified	S000007590
This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community. Gene name reserved on: 2001-02-14. Gene name expires on 2002-02-14.
Description
Protein involved in bud-site selection; diploid mutants display a random budding pattern instead of the wild-type bipolar pattern

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By molecular_function unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD    ND : No Biological Data Available Assigned on 2001-03-02 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By cellular bud site selection Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70        IMP : Inferred from Mutant Phenotype Assigned on 2002-10-10 SGD response to DNA damage stimulus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0227 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By cellular_component unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD    ND : No Biological Data Available Assigned on 2001-03-02 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forBUD25/YER014C-A for BUD25 1) Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for BUD25/YER014C-A

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for BUD25/YER014C-A

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MFCTWDS C-term NQVSKAL Length(aa) 153 MW(Da) 18,006 pI 7.38 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.185   Codon Adaptation Index 0.184   Frequency of Optimal Codons 0.535   Hydropathicity of Protein -0.043   Aromaticity Score 0.176	10 20 30 40 50 | | | | | MFCTWDSWDTGTSRKSHSPHRNCLAVRFLQLPFSSFLPCVITYMKSWQTS IGDSEFPLTSFQILVTDAEVVVQRIFDCINGYLPGWHYRNTVFIEHTTSY HRSHFCIFVEGVWVCGEFVKKWFEIPFDNRIENYTKQFPWILIGFGNQVS KAL*

Protein Structures from PDB: proteins of known structure with sequence similarity to BUD25/YER014C-A, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Date Standardized	Reference
BUD25	2001-08-13	Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70

Other Notes

Date

Note

2001-02-14

This ORF, YER014C-A, was added with a gene name reservation for BUD25. It is flagged as questionable by MIPS and exhibits overlap with neighboring ORFs; however, phenotypes have been observed in bud25 mutants, see Tong AH, et al. (2004) Global Mapping of the Yeast Genetic Interaction Network. Science 303(5659):808-813 and Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70.

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YER014C-A	SGD Systematic Sequence
856735	NCBI: Gene ID
NP_076437.1	NCBI: RefSeq protein version ID
NP_076437.1	NCBI: RefSeq protein version ID
13112038	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
12 curated references; 0 references not yet curated
Mutants/Phenotypes	Jin YH, et al. (2008) Global transcriptome and deletome profiles of yeast exposed to transition metals. PLoS Genet 4(4):e1000053	|ADH1 |ARN1 |ARN2 |ATM1 |ATX1 |BCK1 |BNI1 |BSD2 |BUD16 |CCC2 |CKA1 |CKA2 |CKB2 |CLN3 |MORE
RNA Levels and Processing	Lee A, et al. (2008) Novel low abundance and transient RNAs in yeast revealed by tiling microarrays and ultra high-throughput sequencing are not conserved across closely related yeast species. PLoS Genet 4(12):e1000299	|GCR1 |HSP12 |KEM1 |LSM1 |PAT1 |RPL28 |RRP6 |SKI2 |SKI8
DNA/RNA Sequence Features Mutants/Phenotypes Strains/Constructs	Parenteau J, et al. (2008) Deletion of Many Yeast Introns Reveals a Minority of Genes that Require Splicing for Function. Mol Biol Cell 19(5):1932-41	|ACT1 |ARP2 |ARP9 |CIN2 |COF1 |DYN2 |GIM5 |GLC7 |HNT1 |HOP2 |LSB3 |MOB1 |MOB2 |MTR2 |MORE
Other Features	Nishida H (2006) Detection and Characterization of Fungal-Specific Proteins in Saccharomyces cerevisiae. Biosci Biotechnol Biochem 70(11):2646-52	|AGA1 |AIM26 |COX14 |CWP2 |DDR2 |DSE2 |FYV5 |HOR7 |MFA1 |MFA2 |TOS6 |YAL064W-B |YAR068W |YBL039W-B |MORE
Regulation of Transcription	Purevdorj-Gage B, et al. (2006) Effects of low-shear modeled microgravity on cell function, gene expression, and phenotype in Saccharomyces cerevisiae. Appl Environ Microbiol 72(7):4569-75	|BUD5 |DSE1 |DSE2 |DSE4 |EGT2 |RAX1 |RAX2
Mutants/Phenotypes	Rand JD and Grant CM (2006) The thioredoxin system protects ribosomes against stress-induced aggregation. Mol Biol Cell 17(1):387-401	|AAT2 |ADH1 |ADK1 |AFR1 |AKR1 |ANP1 |APQ13 |ARO2 |ARP8 |ARV1 |ARX1 |ATP12 |ATP2 |BEM1 |MORE
Genetic Interactions Strains/Constructs	Parsons AB, et al. (2004) Integration of chemical-genetic and genetic interaction data links bioactive compounds to cellular target pathways. Nat Biotechnol 22(1):62-9	|ARV1 |BEM1 |BEM2 |BRE1 |BRE2 |BTS1 |CAX4 |CHO2 |CIK1 |CIN1 |CIN2 |CIN4 |CLB3 |CNB1 |MORE
Mutants/Phenotypes	Serrano R, et al. (2004) Copper and iron are the limiting factors for growth of the yeast Saccharomyces cerevisiae in an alkaline environment. J Biol Chem 279(19):19698-704	|AFT1 |ATX1 |BEM1 |BSD2 |CCC2 |CCS1 |COX17 |CTR1 |CUP5 |DIA2 |ERG2 |ERG6 |FET3 |FET4 |MORE
Genetic Interactions Strains/Constructs	Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13	|AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Mutants/Phenotypes Strains/Constructs	Chang M, et al. (2002) A genome-wide screen for methyl methanesulfonate-sensitive mutants reveals genes required for S phase progression in the presence of DNA damage. Proc Natl Acad Sci U S A 99(26):16934-9	|AAT2 |APN1 |ARO1 |ARO7 |ASF1 |BDF1 |BUR2 |CAC2 |CCS1 |CDC40 |CDC50 |CHL1 |CIK1 |COA4 |MORE
Function/Process Mutants/Phenotypes	Dimmer KS, et al. (2002) Genetic basis of mitochondrial function and morphology in Saccharomyces cerevisiae. Mol Biol Cell 13(3):847-53	|ABF2 |ACO1 |ADA2 |ADK1 |AEP1 |AEP2 |AEP3 |AFG3 |AFT1 |AIM10 |AIM22 |ALY1 |APQ13 |ARG82 |MORE
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70	|ALG8 |BUD13 |BUD14 |BUD16 |BUD17 |BUD19 |BUD20 |BUD21 |BUD22 |BUD23 |BUD26 |BUD27 |BUD28 |BUD30 |MORE

Return to SGD

Send a Message to the SGD Curators