---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

SNA2/YDR525W-A Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrIV: 1490589 to 1490828 CDS: 1490589 - 1490828 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
SNA2	YDR525W-A		ORF, Verified	S000007236
Description
Protein of unknown function, has similarity to Pmp3p, which is involved in cation transport; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By molecular_function unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD    ND : No Biological Data Available Assigned on 2002-10-18 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By biological_process unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD    ND : No Biological Data Available Assigned on 2002-10-18 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By cytoplasm Huh WK, et al. (2003) Global analysis of protein localization in budding yeast. Nature 425(6959):686-91          IDA : Inferred from Direct Assay Assigned on 2003-10-28 SGD integral to membrane Kim H, et al. (2003) Topology models for 37 Saccharomyces cerevisiae membrane proteins based on C-terminal reporter fusions and predictions. J Biol Chem 278(12):10208-13          ISM : Inferred from Sequence Model Assigned on 2009-08-26 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000612 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB lipid particle GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0551 Assigned on 2008-02-14 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2009-06-29 UniProtKB monolayer-surrounded lipid storage body GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0154 Assigned on 2008-02-13 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forSNA2/YDR525W-A for SNA2 1) Reggiori F and Pelham HR (2001) Sorting of proteins into multivesicular bodies: ubiquitin-dependent and -independent targeting. EMBO J 20(18):5176-86        2) Huh WK, et al. (2003) Global analysis of protein localization in budding yeast. Nature 425(6959):686-91

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SNA2/YDR525W-A

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SNA2/YDR525W-A

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MHARDWF C-term DNYGSLA Length(aa) 79 MW(Da) 9,180 pI 6.5 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.018   Codon Adaptation Index 0.137   Frequency of Optimal Codons 0.395   Hydropathicity of Protein 0.504   Aromaticity Score 0.190	10 20 30 40 50 | | | | | MHARDWFLVFIAIFIPPLAVWLKRGFFTKDLLINFLLFLLGFFPGLIHAL YVISCHPYEENEARYSHLSSSDDNYGSLA*

Protein Structures from PDB: proteins of known structure with sequence similarity to SNA2/YDR525W-A, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
SNA2	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YDR525W-A	SGD Systematic Sequence
852138	NCBI: Gene ID
NP_010814.1	NCBI: RefSeq protein version ID
NP_010814.1	NCBI: RefSeq protein version ID
6320734	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
8 curated references; 0 references not yet curated
Mutants/Phenotypes	Wagner A, et al. (2009) Mobilization of steryl esters from lipid particles of the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1791(2):118-24	|ATG15 |BSC2 |COY1 |CST26 |EHT1 |HFD1 |LDB16 |NUS1 |OSW5 |PET10 |SNX41 |SSO1 |TGL1 |TGL2 |MORE
Mutants/Phenotypes	Giorgini F, et al. (2008) Histone deacetylase inhibition modulates kynurenine pathway activation in yeast, microglia, and mice expressing a mutant huntingtin fragment. J Biol Chem 283(12):7390-400	|AIM21 |ARG7 |ATG32 |BFR1 |BNA4 |CYK3 |DEF1 |HSP104 |INM2 |MBF1 |MGT1 |MSO1 |NHP6A |PAF1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Norambuena L, et al. (2008) Identification of cellular pathways affected by Sortin2, a synthetic compound that affects protein targeting to the vacuole in Saccharomyces cerevisiae. BMC Chem Biol 8:1	|ASG1 |DCR2 |DID2 |EOS1 |GIM5 |GVP36 |ICS3 |LDB18 |MAK3 |MDY2 |MTQ1 |NHX1 |OCA4 |OPI6 |MORE
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Mutants/Phenotypes RNA Levels and Processing Regulation of Strains/Constructs	Jones DL, et al. (2004) Genome-Wide Analysis of the Effects of Heat Shock on a Saccharomyces cerevisiae Mutant With a Constitutively Activated cAMP-Dependent Pathway. Comp Funct Genomics 5(5):419-31	|BTN2 |COX6 |DCS1 |ENO1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG26 |ERG27 |ERG3 |MORE
Cellular Location Strains/Constructs	Huh WK, et al. (2003) Global analysis of protein localization in budding yeast. Nature 425(6959):686-91	|AAH1 |AAP1 |ABZ1 |ABZ2 |ACB1 |ACO2 |ADD37 |ADD66 |ADE1 |ADE12 |ADE2 |ADE3 |ADE4 |ADE6 |MORE
Cellular Location Protein Physical Properties	Kim H, et al. (2003) Topology models for 37 Saccharomyces cerevisiae membrane proteins based on C-terminal reporter fusions and predictions. J Biol Chem 278(12):10208-13	|AQY1 |ASG7 |ATO2 |AVT6 |CDC1 |ECM7 |ERP2 |ERV15 |FCY2 |FLD1 |HHY1 |IZH4 |MEP1 |MUP1 |MORE
Cellular Location Function/Process Mutants/Phenotypes Strains/Constructs	Reggiori F and Pelham HR (2001) Sorting of proteins into multivesicular bodies: ubiquitin-dependent and -independent targeting. EMBO J 20(18):5176-86	|CPS1 |DOA4 |HMX1 |PPN1 |SNA3 |SNA4

Return to SGD

Send a Message to the SGD Curators